BLASTX nr result
ID: Glycyrrhiza30_contig00025621
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00025621 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH11544.1 hypothetical protein GLYMA_15G116100 [Glycine max] 52 2e-07 >KRH11544.1 hypothetical protein GLYMA_15G116100 [Glycine max] Length = 96 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +3 Query: 27 LTETQQGTHNNRPDSFYNGFDLATAAMAHSRSRVLVF 137 +TET +G HNNRP SF N D+ATA MAHSRSRV F Sbjct: 1 MTETPKGYHNNRPVSFCNRIDIATATMAHSRSRVHFF 37 Score = 29.6 bits (65), Expect(2) = 2e-07 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +1 Query: 133 FFVPTLPLVHVASSQEVPNQI 195 FF TLPLVHVAS QE Q+ Sbjct: 36 FFAETLPLVHVASPQEHQYQL 56