BLASTX nr result
ID: Glycyrrhiza30_contig00025449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00025449 (515 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004487033.1 PREDICTED: methyl-CpG-binding domain-containing p... 105 6e-25 XP_013465377.1 methyl-CpG-binding domain protein [Medicago trunc... 99 1e-22 GAU27212.1 hypothetical protein TSUD_108030 [Trifolium subterran... 100 2e-22 XP_003597337.2 methyl-CpG-binding domain protein [Medicago trunc... 99 7e-22 KRH10296.1 hypothetical protein GLYMA_15G040900 [Glycine max] 94 5e-21 KRH48881.1 hypothetical protein GLYMA_07G118700 [Glycine max] 93 7e-21 XP_016172095.1 PREDICTED: methyl-CpG-binding domain-containing p... 95 9e-21 XP_006583514.1 PREDICTED: methyl-CpG-binding domain-containing p... 93 3e-20 XP_015935702.1 PREDICTED: methyl-CpG-binding domain-containing p... 93 5e-20 XP_003529018.1 PREDICTED: methyl-CpG-binding domain-containing p... 93 6e-20 KHN01604.1 Methyl-CpG-binding domain-containing protein 7 [Glyci... 93 1e-19 XP_003597335.2 ribosomal protein L5 [Medicago truncatula] AES675... 91 2e-19 XP_013454611.1 methyl-CpG-binding domain protein [Medicago trunc... 92 2e-19 XP_014620665.1 PREDICTED: uncharacterized protein LOC100779601 i... 91 2e-19 ABN06005.1 Methyl-CpG binding, putative [Medicago truncatula] 91 2e-19 NP_001242214.1 uncharacterized protein LOC100779601 [Glycine max... 91 3e-19 XP_006593405.1 PREDICTED: uncharacterized protein LOC100779601 i... 91 4e-19 KYP58565.1 hypothetical protein KK1_013979, partial [Cajanus cajan] 88 3e-18 XP_019436228.1 PREDICTED: methyl-CpG-binding domain-containing p... 86 2e-17 XP_019436225.1 PREDICTED: methyl-CpG-binding domain-containing p... 86 2e-17 >XP_004487033.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Cicer arietinum] Length = 222 Score = 105 bits (261), Expect = 6e-25 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIHEGI 342 GEDDRGS+HNL RPP KVSWVL+GPGG W+PF+DDS VPE EKLKWS+AF+ SI+EG+ Sbjct: 163 GEDDRGSVHNLTRPPTKVSWVLAGPGGLWNPFLDDSLVPESEKLKWSKAFITSINEGV 220 >XP_013465377.1 methyl-CpG-binding domain protein [Medicago truncatula] KEH39412.1 methyl-CpG-binding domain protein [Medicago truncatula] Length = 204 Score = 98.6 bits (244), Expect = 1e-22 Identities = 45/61 (73%), Positives = 49/61 (80%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIHEGIIN 336 GEDDRGSIHNL RPP KVSWVLS P GFW+PF+DDS VP EK KWSEAF SI+EG + Sbjct: 141 GEDDRGSIHNLARPPTKVSWVLSDPRGFWNPFLDDSVVPASEKRKWSEAFSISINEGATS 200 Query: 335 G 333 G Sbjct: 201 G 201 >GAU27212.1 hypothetical protein TSUD_108030 [Trifolium subterraneum] Length = 308 Score = 100 bits (249), Expect = 2e-22 Identities = 45/60 (75%), Positives = 49/60 (81%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIHEGIIN 336 GED RGSIHNL RPP KVSWVLSGPGG W+PF+DDS VP EK KWSEAF SI+EG+ N Sbjct: 249 GEDGRGSIHNLTRPPTKVSWVLSGPGGLWNPFLDDSIVPASEKAKWSEAFSISINEGVTN 308 >XP_003597337.2 methyl-CpG-binding domain protein [Medicago truncatula] ABD32284.2 Methyl-CpG binding [Medicago truncatula] AFK39448.1 unknown [Medicago truncatula] AES67588.2 methyl-CpG-binding domain protein [Medicago truncatula] Length = 286 Score = 98.6 bits (244), Expect = 7e-22 Identities = 45/61 (73%), Positives = 49/61 (80%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIHEGIIN 336 GEDDRGSIHNL RPP KVSWVLS P GFW+PF+DDS VP EK KWSEAF SI+EG + Sbjct: 223 GEDDRGSIHNLARPPTKVSWVLSDPRGFWNPFLDDSVVPASEKRKWSEAFSISINEGATS 282 Query: 335 G 333 G Sbjct: 283 G 283 >KRH10296.1 hypothetical protein GLYMA_15G040900 [Glycine max] Length = 180 Score = 94.0 bits (232), Expect = 5e-21 Identities = 46/62 (74%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = -1 Query: 512 EDDRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 +D+R S+HNL PP AKVSWVLS PGGFWSPF+DDS VPE EKLKWS+AFV SIH +G I Sbjct: 116 DDNRASMHNLTAPPPAKVSWVLSSPGGFWSPFLDDSIVPESEKLKWSKAFVLSIHDDGGI 175 Query: 338 NG 333 NG Sbjct: 176 NG 177 >KRH48881.1 hypothetical protein GLYMA_07G118700 [Glycine max] Length = 154 Score = 92.8 bits (229), Expect = 7e-21 Identities = 45/61 (73%), Positives = 51/61 (83%), Gaps = 2/61 (3%) Frame = -1 Query: 512 EDDRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 +D+R S+HNL PP AKVSWVLSGPGGFWSP +DDS VPE EKLKWSEAFV SIH +G+ Sbjct: 93 KDNRASMHNLTAPPPAKVSWVLSGPGGFWSPSLDDSIVPESEKLKWSEAFVLSIHNDGVT 152 Query: 338 N 336 N Sbjct: 153 N 153 >XP_016172095.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Arachis ipaensis] XP_016172096.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Arachis ipaensis] Length = 256 Score = 95.1 bits (235), Expect = 9e-21 Identities = 43/55 (78%), Positives = 46/55 (83%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH 351 G+D+R IHNLP PP KV+WVLSGPGGFWSP VDDS V E EKLKWSEAFV SIH Sbjct: 199 GKDNRSYIHNLPPPPEKVTWVLSGPGGFWSPSVDDSVVAESEKLKWSEAFVLSIH 253 >XP_006583514.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X2 [Glycine max] KRH48878.1 hypothetical protein GLYMA_07G118700 [Glycine max] KRH48879.1 hypothetical protein GLYMA_07G118700 [Glycine max] KRH48880.1 hypothetical protein GLYMA_07G118700 [Glycine max] Length = 217 Score = 92.8 bits (229), Expect = 3e-20 Identities = 45/61 (73%), Positives = 51/61 (83%), Gaps = 2/61 (3%) Frame = -1 Query: 512 EDDRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 +D+R S+HNL PP AKVSWVLSGPGGFWSP +DDS VPE EKLKWSEAFV SIH +G+ Sbjct: 156 KDNRASMHNLTAPPPAKVSWVLSGPGGFWSPSLDDSIVPESEKLKWSEAFVLSIHNDGVT 215 Query: 338 N 336 N Sbjct: 216 N 216 >XP_015935702.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Arachis duranensis] XP_015935703.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Arachis duranensis] Length = 257 Score = 93.2 bits (230), Expect = 5e-20 Identities = 42/55 (76%), Positives = 46/55 (83%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH 351 G+D+R IHNLP PP KV+WVLSGPGGFWSP V+DS V E EKLKWSEAFV SIH Sbjct: 200 GKDNRSYIHNLPPPPEKVTWVLSGPGGFWSPSVNDSVVAESEKLKWSEAFVLSIH 254 >XP_003529018.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Glycine max] XP_006583513.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Glycine max] KRH48876.1 hypothetical protein GLYMA_07G118700 [Glycine max] KRH48877.1 hypothetical protein GLYMA_07G118700 [Glycine max] Length = 251 Score = 92.8 bits (229), Expect = 6e-20 Identities = 45/61 (73%), Positives = 51/61 (83%), Gaps = 2/61 (3%) Frame = -1 Query: 512 EDDRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 +D+R S+HNL PP AKVSWVLSGPGGFWSP +DDS VPE EKLKWSEAFV SIH +G+ Sbjct: 190 KDNRASMHNLTAPPPAKVSWVLSGPGGFWSPSLDDSIVPESEKLKWSEAFVLSIHNDGVT 249 Query: 338 N 336 N Sbjct: 250 N 250 >KHN01604.1 Methyl-CpG-binding domain-containing protein 7 [Glycine soja] Length = 282 Score = 92.8 bits (229), Expect = 1e-19 Identities = 45/61 (73%), Positives = 51/61 (83%), Gaps = 2/61 (3%) Frame = -1 Query: 512 EDDRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 +D+R S+HNL PP AKVSWVLSGPGGFWSP +DDS VPE EKLKWSEAFV SIH +G+ Sbjct: 221 KDNRASMHNLTAPPPAKVSWVLSGPGGFWSPSLDDSIVPESEKLKWSEAFVLSIHNDGVT 280 Query: 338 N 336 N Sbjct: 281 N 281 >XP_003597335.2 ribosomal protein L5 [Medicago truncatula] AES67586.2 ribosomal protein L5 [Medicago truncatula] Length = 230 Score = 91.3 bits (225), Expect = 2e-19 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAF 366 GEDD GSIHNL +PP KVSWVLSGPGGFWSPF+DDS VP EK KW+E F Sbjct: 176 GEDDGGSIHNLTKPPTKVSWVLSGPGGFWSPFLDDSIVPTSEKTKWNETF 225 >XP_013454611.1 methyl-CpG-binding domain protein [Medicago truncatula] KEH28642.1 methyl-CpG-binding domain protein [Medicago truncatula] Length = 250 Score = 91.7 bits (226), Expect = 2e-19 Identities = 44/66 (66%), Positives = 50/66 (75%), Gaps = 2/66 (3%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH--EGI 342 GEDDRGSIHNL +PP KVSWVLS P GFW+PF+DD VP EK KWSEAF SI+ EG Sbjct: 185 GEDDRGSIHNLTKPPTKVSWVLSSPEGFWNPFLDDYIVPASEKRKWSEAFSISINEFEGA 244 Query: 341 INGQWS 324 +G +S Sbjct: 245 TSGVYS 250 >XP_014620665.1 PREDICTED: uncharacterized protein LOC100779601 isoform X2 [Glycine max] Length = 250 Score = 91.3 bits (225), Expect = 2e-19 Identities = 45/62 (72%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = -1 Query: 512 EDDRGSIHNLP-RPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 +D+R S+HNL PPAKVSWVLSG GGFWSPF+DDS VPE EK+KWS+AFV SIH +G I Sbjct: 186 KDNRASMHNLTVPPPAKVSWVLSGSGGFWSPFLDDSIVPEPEKMKWSKAFVLSIHDDGDI 245 Query: 338 NG 333 NG Sbjct: 246 NG 247 >ABN06005.1 Methyl-CpG binding, putative [Medicago truncatula] Length = 251 Score = 91.3 bits (225), Expect = 2e-19 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAF 366 GEDD GSIHNL +PP KVSWVLSGPGGFWSPF+DDS VP EK KW+E F Sbjct: 197 GEDDGGSIHNLTKPPTKVSWVLSGPGGFWSPFLDDSIVPTSEKTKWNETF 246 >NP_001242214.1 uncharacterized protein LOC100779601 [Glycine max] ACU17620.1 unknown [Glycine max] Length = 261 Score = 91.3 bits (225), Expect = 3e-19 Identities = 45/62 (72%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = -1 Query: 512 EDDRGSIHNLP-RPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 +D+R S+HNL PPAKVSWVLSG GGFWSPF+DDS VPE EK+KWS+AFV SIH +G I Sbjct: 197 KDNRASMHNLTVPPPAKVSWVLSGSGGFWSPFLDDSIVPEPEKMKWSKAFVLSIHDDGDI 256 Query: 338 NG 333 NG Sbjct: 257 NG 258 >XP_006593405.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_006593406.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_006593407.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_014620661.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_014620662.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_014620663.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_014620664.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] KHN30197.1 Methyl-CpG-binding domain-containing protein 7 [Glycine soja] KRH23023.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23024.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23025.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23026.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23027.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23028.1 hypothetical protein GLYMA_13G333300 [Glycine max] Length = 282 Score = 91.3 bits (225), Expect = 4e-19 Identities = 45/62 (72%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = -1 Query: 512 EDDRGSIHNLP-RPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 +D+R S+HNL PPAKVSWVLSG GGFWSPF+DDS VPE EK+KWS+AFV SIH +G I Sbjct: 218 KDNRASMHNLTVPPPAKVSWVLSGSGGFWSPFLDDSIVPEPEKMKWSKAFVLSIHDDGDI 277 Query: 338 NG 333 NG Sbjct: 278 NG 279 >KYP58565.1 hypothetical protein KK1_013979, partial [Cajanus cajan] Length = 227 Score = 87.8 bits (216), Expect = 3e-18 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 2/62 (3%) Frame = -1 Query: 512 EDDRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGII 339 E++R S+HNL PP AKVSWVLS PGGFW PF+DDS V E EKLKWSEAFV SI+ +G++ Sbjct: 163 ENNRVSMHNLTEPPPAKVSWVLSCPGGFWCPFLDDSVVSESEKLKWSEAFVLSIYGDGVL 222 Query: 338 NG 333 NG Sbjct: 223 NG 224 >XP_019436228.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X2 [Lupinus angustifolius] Length = 244 Score = 86.3 bits (212), Expect = 2e-17 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH 351 G D+R +HNL +PPAKV WVLSG GG W+PF+DDS VP+ EKLKWSEAFV SI+ Sbjct: 189 GTDNRPCMHNLSKPPAKVKWVLSGSGGCWNPFLDDSIVPDSEKLKWSEAFVLSIN 243 >XP_019436225.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Lupinus angustifolius] XP_019436226.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Lupinus angustifolius] XP_019436227.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Lupinus angustifolius] Length = 247 Score = 86.3 bits (212), Expect = 2e-17 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -1 Query: 515 GEDDRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH 351 G D+R +HNL +PPAKV WVLSG GG W+PF+DDS VP+ EKLKWSEAFV SI+ Sbjct: 192 GTDNRPCMHNLSKPPAKVKWVLSGSGGCWNPFLDDSIVPDSEKLKWSEAFVLSIN 246