BLASTX nr result
ID: Glycyrrhiza30_contig00025447
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00025447 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006599370.1 PREDICTED: auxilin-related protein 2-like [Glycin... 74 7e-15 KHN11110.1 Auxilin-related protein 1 [Glycine soja] 74 3e-13 KHN36088.1 Auxilin-related protein 2 [Glycine soja] 74 4e-13 OIV94807.1 hypothetical protein TanjilG_22004 [Lupinus angustifo... 74 4e-13 XP_019421915.1 PREDICTED: auxilin-related protein 1-like [Lupinu... 74 4e-13 KYP53181.1 UBA domain-containing protein 7 [Cajanus cajan] 74 4e-13 XP_007156969.1 hypothetical protein PHAVU_002G032500g [Phaseolus... 74 4e-13 KYP66796.1 UBA domain-containing protein 7 [Cajanus cajan] 74 4e-13 KHN41951.1 Auxilin-related protein 2 [Glycine soja] 74 4e-13 XP_003537600.2 PREDICTED: auxilin-like protein 1 isoform X1 [Gly... 74 4e-13 KRH76749.1 hypothetical protein GLYMA_01G172200 [Glycine max] KR... 74 4e-13 XP_014519207.1 PREDICTED: auxilin-like protein 1 isoform X2 [Vig... 74 4e-13 XP_006573573.1 PREDICTED: auxilin-like protein 1 [Glycine max] X... 74 4e-13 XP_014519206.1 PREDICTED: auxilin-like protein 1 isoform X1 [Vig... 74 4e-13 XP_017427561.1 PREDICTED: auxilin-like protein 1 [Vigna angulari... 74 4e-13 XP_007156063.1 hypothetical protein PHAVU_003G255200g [Phaseolus... 74 4e-13 XP_007156064.1 hypothetical protein PHAVU_003G255200g [Phaseolus... 74 4e-13 XP_013446396.1 chaperone DnaJ-domain protein, putative [Medicago... 74 4e-13 XP_012573701.1 PREDICTED: auxilin-like protein 1 [Cicer arietinum] 74 4e-13 XP_014510655.1 PREDICTED: auxilin-like protein 1 [Vigna radiata ... 74 4e-13 >XP_006599370.1 PREDICTED: auxilin-related protein 2-like [Glycine max] Length = 114 Score = 74.3 bits (181), Expect = 7e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 80 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 114 >KHN11110.1 Auxilin-related protein 1 [Glycine soja] Length = 488 Score = 74.3 bits (181), Expect = 3e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 454 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 488 >KHN36088.1 Auxilin-related protein 2 [Glycine soja] Length = 862 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 828 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 862 >OIV94807.1 hypothetical protein TanjilG_22004 [Lupinus angustifolius] Length = 1295 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1261 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1295 >XP_019421915.1 PREDICTED: auxilin-related protein 1-like [Lupinus angustifolius] Length = 1298 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1264 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1298 >KYP53181.1 UBA domain-containing protein 7 [Cajanus cajan] Length = 1313 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1279 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1313 >XP_007156969.1 hypothetical protein PHAVU_002G032500g [Phaseolus vulgaris] ESW28963.1 hypothetical protein PHAVU_002G032500g [Phaseolus vulgaris] Length = 1329 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1295 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1329 >KYP66796.1 UBA domain-containing protein 7 [Cajanus cajan] Length = 1349 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1315 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1349 >KHN41951.1 Auxilin-related protein 2 [Glycine soja] Length = 1388 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1354 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1388 >XP_003537600.2 PREDICTED: auxilin-like protein 1 isoform X1 [Glycine max] KRH28713.1 hypothetical protein GLYMA_11G071000 [Glycine max] Length = 1388 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1354 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1388 >KRH76749.1 hypothetical protein GLYMA_01G172200 [Glycine max] KRH76750.1 hypothetical protein GLYMA_01G172200 [Glycine max] Length = 1396 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1362 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1396 >XP_014519207.1 PREDICTED: auxilin-like protein 1 isoform X2 [Vigna radiata var. radiata] Length = 1399 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1365 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1399 >XP_006573573.1 PREDICTED: auxilin-like protein 1 [Glycine max] XP_014631330.1 PREDICTED: auxilin-like protein 1 [Glycine max] XP_014631332.1 PREDICTED: auxilin-like protein 1 [Glycine max] KRH76751.1 hypothetical protein GLYMA_01G172200 [Glycine max] KRH76752.1 hypothetical protein GLYMA_01G172200 [Glycine max] KRH76753.1 hypothetical protein GLYMA_01G172200 [Glycine max] KRH76754.1 hypothetical protein GLYMA_01G172200 [Glycine max] Length = 1404 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1370 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1404 >XP_014519206.1 PREDICTED: auxilin-like protein 1 isoform X1 [Vigna radiata var. radiata] Length = 1407 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1373 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1407 >XP_017427561.1 PREDICTED: auxilin-like protein 1 [Vigna angularis] KOM45174.1 hypothetical protein LR48_Vigan06g048000 [Vigna angularis] BAU00047.1 hypothetical protein VIGAN_10160500 [Vigna angularis var. angularis] Length = 1409 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1375 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1409 >XP_007156063.1 hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] ESW28057.1 hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] Length = 1421 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1387 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1421 >XP_007156064.1 hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] ESW28058.1 hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] Length = 1422 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1388 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1422 >XP_013446396.1 chaperone DnaJ-domain protein, putative [Medicago truncatula] KEH20423.1 chaperone DnaJ-domain protein, putative [Medicago truncatula] Length = 1441 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLK+AWSKFNSEER Sbjct: 1407 DKLQQRGASIQHKYICEKVFDLLKDAWSKFNSEER 1441 >XP_012573701.1 PREDICTED: auxilin-like protein 1 [Cicer arietinum] Length = 1447 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1413 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1447 >XP_014510655.1 PREDICTED: auxilin-like protein 1 [Vigna radiata var. radiata] Length = 1485 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 1 DKLQQRGASVQHKYICEKVFDLLKEAWSKFNSEER 105 DKLQQRGAS+QHKYICEKVFDLLKEAW+KFNSEER Sbjct: 1451 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEER 1485