BLASTX nr result
ID: Glycyrrhiza30_contig00025441
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00025441 (590 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP39662.1 Putative pentatricopeptide repeat-containing protein ... 69 4e-11 XP_006590792.1 PREDICTED: putative pentatricopeptide repeat-cont... 67 2e-10 KHN32303.1 Putative pentatricopeptide repeat-containing protein ... 67 2e-10 XP_019413691.1 PREDICTED: putative pentatricopeptide repeat-cont... 65 7e-10 OIV99596.1 hypothetical protein TanjilG_17406 [Lupinus angustifo... 65 7e-10 KHN05463.1 Putative pentatricopeptide repeat-containing protein ... 65 9e-10 XP_006592041.1 PREDICTED: putative pentatricopeptide repeat-cont... 65 9e-10 XP_014494570.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 3e-09 XP_017433652.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 3e-09 XP_015952700.1 PREDICTED: putative pentatricopeptide repeat-cont... 63 2e-08 XP_007131603.1 hypothetical protein PHAVU_011G027200g [Phaseolus... 60 2e-08 XP_004505699.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 2e-08 XP_016191662.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 2e-08 GAU39968.1 hypothetical protein TSUD_61570 [Trifolium subterraneum] 62 1e-07 XP_011000283.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 1e-07 XP_011000284.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 1e-07 XP_007016495.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 2e-07 XP_002298371.2 hypothetical protein POPTR_0001s24340g [Populus t... 59 2e-07 OMO91295.1 hypothetical protein COLO4_18464 [Corchorus olitorius] 60 3e-07 XP_010253257.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 3e-07 >KYP39662.1 Putative pentatricopeptide repeat-containing protein At5g59900 family [Cajanus cajan] Length = 893 Score = 68.6 bits (166), Expect(2) = 4e-11 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NLFGL 395 LN+GL PDL CN LIYGCCV+GE+ +AF L +DMLRR +KPR NL L Sbjct: 842 LNKGLEPDLVACNLLIYGCCVNGEIDKAFELRDDMLRRGMKPRQNLKAL 890 Score = 26.6 bits (57), Expect(2) = 4e-11 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+G AV+LW N+L Sbjct: 827 RSGNVGPAVKLWDNML 842 >XP_006590792.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Glycine max] KRH29123.1 hypothetical protein GLYMA_11G098900 [Glycine max] Length = 900 Score = 66.6 bits (161), Expect(2) = 2e-10 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NLFGL 395 LN+GL PDL N LIYGCCV+GEL +AF L +DMLRR VKPR NL L Sbjct: 843 LNKGLEPDLVAYNLLIYGCCVNGELNKAFELRDDMLRRGVKPRQNLQAL 891 Score = 26.2 bits (56), Expect(2) = 2e-10 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GAAV+LW +L Sbjct: 828 RSGNVGAAVKLWDTML 843 >KHN32303.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 827 Score = 66.6 bits (161), Expect(2) = 2e-10 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NLFGL 395 LN+GL PDL N LIYGCCV+GEL +AF L +DMLRR VKPR NL L Sbjct: 770 LNKGLEPDLVAYNLLIYGCCVNGELNKAFELRDDMLRRGVKPRQNLQAL 818 Score = 26.2 bits (56), Expect(2) = 2e-10 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GAAV+LW +L Sbjct: 755 RSGNVGAAVKLWDTML 770 >XP_019413691.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Lupinus angustifolius] Length = 906 Score = 64.7 bits (156), Expect(2) = 7e-10 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*N 407 LN+GL PDL N LIYGCCV+GEL +AF L +DMLRR VKPR N Sbjct: 849 LNKGLEPDLVAYNLLIYGCCVNGELNKAFQLRDDMLRRGVKPRQN 893 Score = 26.2 bits (56), Expect(2) = 7e-10 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GAAV+LW +L Sbjct: 834 RSGNVGAAVKLWDTML 849 >OIV99596.1 hypothetical protein TanjilG_17406 [Lupinus angustifolius] Length = 702 Score = 64.7 bits (156), Expect(2) = 7e-10 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*N 407 LN+GL PDL N LIYGCCV+GEL +AF L +DMLRR VKPR N Sbjct: 645 LNKGLEPDLVAYNLLIYGCCVNGELNKAFQLRDDMLRRGVKPRQN 689 Score = 26.2 bits (56), Expect(2) = 7e-10 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GAAV+LW +L Sbjct: 630 RSGNVGAAVKLWDTML 645 >KHN05463.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 923 Score = 65.5 bits (158), Expect(2) = 9e-10 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NL 404 LN GL PDL N LIYGCCV+GEL +AF L +DMLRR VKPR NL Sbjct: 858 LNRGLEPDLVAYNLLIYGCCVNGELDKAFELRDDMLRRGVKPRQNL 903 Score = 25.0 bits (53), Expect(2) = 9e-10 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GA+V+LW +L Sbjct: 843 RSGNVGASVKLWDTML 858 >XP_006592041.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Glycine max] XP_006592042.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Glycine max] KRH24157.1 hypothetical protein GLYMA_12G024900 [Glycine max] KRH24158.1 hypothetical protein GLYMA_12G024900 [Glycine max] Length = 903 Score = 65.5 bits (158), Expect(2) = 9e-10 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NL 404 LN GL PDL N LIYGCCV+GEL +AF L +DMLRR VKPR NL Sbjct: 846 LNRGLEPDLVAYNLLIYGCCVNGELDKAFELRDDMLRRGVKPRQNL 891 Score = 25.0 bits (53), Expect(2) = 9e-10 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GA+V+LW +L Sbjct: 831 RSGNVGASVKLWDTML 846 >XP_014494570.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Vigna radiata var. radiata] XP_014494571.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Vigna radiata var. radiata] Length = 900 Score = 62.4 bits (150), Expect(2) = 3e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NL 404 L +GL PDL N LIYGCCV+GEL +AF LH+DML+R +KPR +L Sbjct: 843 LKKGLKPDLVAYNLLIYGCCVNGELDKAFELHDDMLKRGMKPRQSL 888 Score = 26.6 bits (57), Expect(2) = 3e-09 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GAAV+LW +L Sbjct: 828 RNGNVGAAVKLWDTML 843 >XP_017433652.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Vigna angularis] XP_017433653.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Vigna angularis] KOM51082.1 hypothetical protein LR48_Vigan08g190900 [Vigna angularis] BAT91124.1 hypothetical protein VIGAN_06243200 [Vigna angularis var. angularis] Length = 900 Score = 62.4 bits (150), Expect(2) = 3e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NL 404 L +GL PDL N LIYGCCV+GEL +AF LH+DML+R +KPR +L Sbjct: 843 LKKGLKPDLVAYNLLIYGCCVNGELDKAFELHDDMLKRGMKPRQSL 888 Score = 26.2 bits (56), Expect(2) = 3e-09 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GAAV LW +L Sbjct: 828 RNGNVGAAVNLWDTML 843 >XP_015952700.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Arachis duranensis] Length = 921 Score = 62.8 bits (151), Expect(2) = 2e-08 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*N 407 LN+GL PDL N L+YGCCV+GEL +AF L +D+LRR VKPR N Sbjct: 862 LNKGLEPDLVAYNLLLYGCCVNGELNKAFELRDDLLRRGVKPRQN 906 Score = 23.5 bits (49), Expect(2) = 2e-08 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+G AV LW +L Sbjct: 847 RSGNVGEAVTLWDTML 862 >XP_007131603.1 hypothetical protein PHAVU_011G027200g [Phaseolus vulgaris] ESW03597.1 hypothetical protein PHAVU_011G027200g [Phaseolus vulgaris] Length = 900 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NL 404 L +GL PDL N LIYGCCV+GEL +AF L +DMLRR + PR NL Sbjct: 843 LKKGLKPDLVAYNLLIYGCCVNGELDKAFELRDDMLRRGMTPRQNL 888 Score = 26.2 bits (56), Expect(2) = 2e-08 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GAAV+LW +L Sbjct: 828 RSGNVGAAVKLWDTML 843 >XP_004505699.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Cicer arietinum] Length = 886 Score = 59.7 bits (143), Expect(2) = 2e-08 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NL 404 L +G+ PD N LIYGCCV+GEL +AF L +DMLRR VKPR NL Sbjct: 835 LEKGVAPDSVAYNLLIYGCCVNGELGKAFELRDDMLRRGVKPRQNL 880 Score = 26.6 bits (57), Expect(2) = 2e-08 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+GAAV+LW +L Sbjct: 820 RNGNVGAAVKLWDTML 835 >XP_016191662.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900, partial [Arachis ipaensis] Length = 872 Score = 62.4 bits (150), Expect(2) = 2e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*N 407 LN+GL PDL N L+YGCC++GEL +AF L +D+LRR VKPR N Sbjct: 815 LNKGLEPDLVAYNLLLYGCCINGELNKAFELRDDLLRRGVKPRQN 859 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 R GN+G AV LW +L Sbjct: 800 RSGNVGEAVRLWDTML 815 >GAU39968.1 hypothetical protein TSUD_61570 [Trifolium subterraneum] Length = 716 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKPR*NL 404 L +G+ PDL N LIYGCCV+GEL +AF L +DMLRR +KPR NL Sbjct: 666 LKKGVEPDLVAYNLLIYGCCVNGELNKAFELRDDMLRRGLKPRKNL 711 >XP_011000283.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Populus euphratica] Length = 945 Score = 58.9 bits (141), Expect(2) = 1e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKP 416 LN+GL PD NFLIYGCC+ GEL +AF L +DM+RR VKP Sbjct: 877 LNKGLKPDTLAYNFLIYGCCIAGELGKAFELRDDMIRRGVKP 918 Score = 24.3 bits (51), Expect(2) = 1e-07 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 RRGN+ A+ELW +L Sbjct: 862 RRGNLVGAIELWDTML 877 >XP_011000284.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X2 [Populus euphratica] Length = 849 Score = 58.9 bits (141), Expect(2) = 1e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKP 416 LN+GL PD NFLIYGCC+ GEL +AF L +DM+RR VKP Sbjct: 781 LNKGLKPDTLAYNFLIYGCCIAGELGKAFELRDDMIRRGVKP 822 Score = 24.3 bits (51), Expect(2) = 1e-07 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 RRGN+ A+ELW +L Sbjct: 766 RRGNLVGAIELWDTML 781 >XP_007016495.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Theobroma cacao] EOY34114.1 Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 910 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKP 416 LN+G+ PD NFLI+GCCV GELK+AF L +DMLRR VKP Sbjct: 846 LNKGIKPDTLAYNFLIHGCCVAGELKKAFALRDDMLRRGVKP 887 >XP_002298371.2 hypothetical protein POPTR_0001s24340g [Populus trichocarpa] EEE83176.2 hypothetical protein POPTR_0001s24340g [Populus trichocarpa] Length = 742 Score = 58.9 bits (141), Expect(2) = 2e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKP 416 LN+GL PD NFLIYGCC+ GEL +AF L +DM+RR VKP Sbjct: 674 LNKGLKPDTLAYNFLIYGCCIAGELGKAFELRDDMIRRGVKP 715 Score = 23.5 bits (49), Expect(2) = 2e-07 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 588 RRGNIGAAVELWYNLL 541 RRGN+ A+E W +L Sbjct: 659 RRGNLDGAIEFWDTML 674 >OMO91295.1 hypothetical protein COLO4_18464 [Corchorus olitorius] Length = 910 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKP 416 LN+G+ PD V +FLI+GCC+ GEL +AF LH+DM+RR VKP Sbjct: 846 LNKGIKPDAVVYSFLIHGCCIAGELNKAFELHDDMMRRGVKP 887 >XP_010253257.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Nelumbo nucifera] XP_010253258.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Nelumbo nucifera] XP_010253259.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Nelumbo nucifera] XP_010253262.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Nelumbo nucifera] XP_010253265.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Nelumbo nucifera] Length = 914 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -2 Query: 541 LNEGL*PDLDVCNFLIYGCCVDGELKEAFGLHNDMLRRAVKP 416 LN G+ PD NFLIYGC V+GEL AF LHNDM+RR VKP Sbjct: 850 LNRGVKPDTLAYNFLIYGCSVNGELTRAFELHNDMMRRGVKP 891