BLASTX nr result
ID: Glycyrrhiza30_contig00025411
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00025411 (396 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP14163.1 glycosyl transferase group 1 [Corchorus olitorius] 50 7e-06 >OMP14163.1 glycosyl transferase group 1 [Corchorus olitorius] Length = 68 Score = 50.4 bits (119), Expect = 7e-06 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +3 Query: 267 EGYVVAQCVYQFPVRLFGDPGRVPIPYIRLS 359 E YVVAQCVYQF VRLF DPG VPIPY LS Sbjct: 13 ELYVVAQCVYQFQVRLFIDPGPVPIPYKGLS 43