BLASTX nr result
ID: Glycyrrhiza30_contig00025301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00025301 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003602152.1 MKS1-like protein [Medicago truncatula] AES72403.... 70 4e-12 GAU47854.1 hypothetical protein TSUD_404310 [Trifolium subterran... 70 4e-12 XP_016165604.1 PREDICTED: protein MKS1 [Arachis ipaensis] 65 2e-10 XP_015934425.1 PREDICTED: protein MKS1 [Arachis duranensis] 65 2e-10 XP_019415212.1 PREDICTED: protein MKS1 [Lupinus angustifolius] O... 63 1e-09 XP_018858272.1 PREDICTED: protein MKS1-like [Juglans regia] 63 2e-09 KRH64520.1 hypothetical protein GLYMA_04G239400 [Glycine max] 62 2e-09 XP_003522552.2 PREDICTED: protein MKS1-like [Glycine max] 62 2e-09 XP_004502599.1 PREDICTED: protein MKS1 [Cicer arietinum] 62 2e-09 KHN44242.1 Protein MKS1 [Glycine soja] 62 2e-09 KYP66261.1 Protein MKS1 [Cajanus cajan] 62 3e-09 AFK48226.1 unknown [Lotus japonicus] 60 9e-09 XP_016571608.1 PREDICTED: protein MKS1-like [Capsicum annuum] 60 1e-08 XP_003544100.1 PREDICTED: nuclear speckle RNA-binding protein B-... 60 1e-08 XP_011101648.1 PREDICTED: protein MKS1 [Sesamum indicum] 59 2e-08 XP_017421314.1 PREDICTED: protein MKS1 [Vigna angularis] BAT7877... 59 4e-08 XP_014522373.1 PREDICTED: protein MKS1 [Vigna radiata var. radiata] 59 4e-08 KOM41439.1 hypothetical protein LR48_Vigan04g163700 [Vigna angul... 59 5e-08 KHN09235.1 Protein MKS1 [Glycine soja] 58 6e-08 XP_007137554.1 hypothetical protein PHAVU_009G136500g [Phaseolus... 58 8e-08 >XP_003602152.1 MKS1-like protein [Medicago truncatula] AES72403.1 MKS1-like protein [Medicago truncatula] Length = 248 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 160 MDQYQDINPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 M+Q+ DI PTGRSPRRELQGPRPTPLRIHKDSHKIKK Sbjct: 1 MNQFPDI-PTGRSPRRELQGPRPTPLRIHKDSHKIKK 36 >GAU47854.1 hypothetical protein TSUD_404310 [Trifolium subterraneum] Length = 253 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 160 MDQYQDINPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 M+Q+ DI PTGRSPRRELQGPRPTPLRIHKDSHKIKK Sbjct: 1 MNQFPDI-PTGRSPRRELQGPRPTPLRIHKDSHKIKK 36 >XP_016165604.1 PREDICTED: protein MKS1 [Arachis ipaensis] Length = 273 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 181 NPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 NPTGRSPRRELQGPRPTPLRI+KDSHKIKK Sbjct: 9 NPTGRSPRRELQGPRPTPLRINKDSHKIKK 38 >XP_015934425.1 PREDICTED: protein MKS1 [Arachis duranensis] Length = 273 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 181 NPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 NPTGRSPRRELQGPRPTPLRI+KDSHKIKK Sbjct: 8 NPTGRSPRRELQGPRPTPLRINKDSHKIKK 37 >XP_019415212.1 PREDICTED: protein MKS1 [Lupinus angustifolius] OIV97980.1 hypothetical protein TanjilG_14080 [Lupinus angustifolius] Length = 225 Score = 62.8 bits (151), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 169 YQDINPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 +QDI+ TGRSPRRELQGPRPTPLRI+KDSHKIKK Sbjct: 3 FQDIS-TGRSPRRELQGPRPTPLRINKDSHKIKK 35 >XP_018858272.1 PREDICTED: protein MKS1-like [Juglans regia] Length = 262 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +1 Query: 160 MDQYQDIN-PTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 MD + N P GRSPRRE+QGPRPTPLR+HKDSHKIKK Sbjct: 15 MDSSGNYNIPAGRSPRREIQGPRPTPLRVHKDSHKIKK 52 >KRH64520.1 hypothetical protein GLYMA_04G239400 [Glycine max] Length = 240 Score = 62.4 bits (150), Expect = 2e-09 Identities = 31/40 (77%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = +1 Query: 157 SMDQYQDINPTGRSPRRELQ--GPRPTPLRIHKDSHKIKK 270 +MDQ+ I PT RSPRRELQ GPRPTPLRI+KDSHKIKK Sbjct: 19 NMDQFSHIIPTERSPRRELQLQGPRPTPLRINKDSHKIKK 58 >XP_003522552.2 PREDICTED: protein MKS1-like [Glycine max] Length = 261 Score = 62.4 bits (150), Expect = 2e-09 Identities = 31/40 (77%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = +1 Query: 157 SMDQYQDINPTGRSPRRELQ--GPRPTPLRIHKDSHKIKK 270 +MDQ+ I PT RSPRRELQ GPRPTPLRI+KDSHKIKK Sbjct: 19 NMDQFSHIIPTERSPRRELQLQGPRPTPLRINKDSHKIKK 58 >XP_004502599.1 PREDICTED: protein MKS1 [Cicer arietinum] Length = 237 Score = 62.0 bits (149), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +1 Query: 160 MDQYQDINPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 M+ DI+ TGRSPRRELQGPRPTPLRIHKDSHKI K Sbjct: 1 MNHLPDIS-TGRSPRRELQGPRPTPLRIHKDSHKISK 36 >KHN44242.1 Protein MKS1 [Glycine soja] Length = 242 Score = 62.0 bits (149), Expect = 2e-09 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +1 Query: 160 MDQYQDINPTGRSPRRELQ--GPRPTPLRIHKDSHKIKK 270 MDQ+ I PT RSPRRELQ GPRPTPLRI+KDSHKIKK Sbjct: 1 MDQFSHIIPTERSPRRELQLQGPRPTPLRINKDSHKIKK 39 >KYP66261.1 Protein MKS1 [Cajanus cajan] Length = 239 Score = 61.6 bits (148), Expect = 3e-09 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +1 Query: 160 MDQYQDINPTGRSPRRELQ--GPRPTPLRIHKDSHKIKK 270 MDQ+ I PT RSPRRELQ GPRPTPLRI+KDSHKIKK Sbjct: 1 MDQFPHIIPTERSPRRELQLQGPRPTPLRINKDSHKIKK 39 >AFK48226.1 unknown [Lotus japonicus] Length = 238 Score = 60.5 bits (145), Expect = 9e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 184 PTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 P GRSPRRELQGPRPTPLRI+KDSHKIKK Sbjct: 8 PMGRSPRRELQGPRPTPLRINKDSHKIKK 36 >XP_016571608.1 PREDICTED: protein MKS1-like [Capsicum annuum] Length = 276 Score = 60.5 bits (145), Expect = 1e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 181 NPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 NP+GRSPRRELQGPRPTPL++ KDSHKI+K Sbjct: 34 NPSGRSPRRELQGPRPTPLKVRKDSHKIRK 63 >XP_003544100.1 PREDICTED: nuclear speckle RNA-binding protein B-like [Glycine max] KHN22188.1 Protein MKS1 [Glycine soja] KRH15991.1 hypothetical protein GLYMA_14G124800 [Glycine max] Length = 237 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 172 QDINPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 QDI P+GRSP+RELQGPRPTPLRI+KDSHKIK+ Sbjct: 4 QDI-PSGRSPKRELQGPRPTPLRINKDSHKIKR 35 >XP_011101648.1 PREDICTED: protein MKS1 [Sesamum indicum] Length = 243 Score = 59.3 bits (142), Expect = 2e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 181 NPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 NP+GRSP+RELQGPRPTPL++ KDSHKI+K Sbjct: 6 NPSGRSPKRELQGPRPTPLKVRKDSHKIRK 35 >XP_017421314.1 PREDICTED: protein MKS1 [Vigna angularis] BAT78776.1 hypothetical protein VIGAN_02150400 [Vigna angularis var. angularis] Length = 265 Score = 58.9 bits (141), Expect = 4e-08 Identities = 31/40 (77%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = +1 Query: 157 SMDQYQDINPTGRSPRRELQ--GPRPTPLRIHKDSHKIKK 270 +MDQ+ I PT RSPRRELQ GPRPTPLRI+KDSHKIKK Sbjct: 21 NMDQFSHI-PTERSPRRELQLQGPRPTPLRINKDSHKIKK 59 >XP_014522373.1 PREDICTED: protein MKS1 [Vigna radiata var. radiata] Length = 266 Score = 58.9 bits (141), Expect = 4e-08 Identities = 31/40 (77%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = +1 Query: 157 SMDQYQDINPTGRSPRRELQ--GPRPTPLRIHKDSHKIKK 270 +MDQ+ I PT RSPRRELQ GPRPTPLRI+KDSHKIKK Sbjct: 17 NMDQFSHI-PTERSPRRELQLQGPRPTPLRINKDSHKIKK 55 >KOM41439.1 hypothetical protein LR48_Vigan04g163700 [Vigna angularis] Length = 244 Score = 58.5 bits (140), Expect = 5e-08 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +1 Query: 160 MDQYQDINPTGRSPRRELQ--GPRPTPLRIHKDSHKIKK 270 MDQ+ I PT RSPRRELQ GPRPTPLRI+KDSHKIKK Sbjct: 1 MDQFSHI-PTERSPRRELQLQGPRPTPLRINKDSHKIKK 38 >KHN09235.1 Protein MKS1 [Glycine soja] Length = 199 Score = 57.8 bits (138), Expect = 6e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 172 QDINPTGRSPRRELQGPRPTPLRIHKDSHKIKK 270 QDI P+GRSP+R+LQGPRP PLRI+KDSHKIKK Sbjct: 4 QDI-PSGRSPKRQLQGPRPPPLRINKDSHKIKK 35 >XP_007137554.1 hypothetical protein PHAVU_009G136500g [Phaseolus vulgaris] ESW09548.1 hypothetical protein PHAVU_009G136500g [Phaseolus vulgaris] Length = 277 Score = 58.2 bits (139), Expect = 8e-08 Identities = 31/40 (77%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = +1 Query: 157 SMDQYQDINPTGRSPRRELQ--GPRPTPLRIHKDSHKIKK 270 +MDQ+ I PT RSPRRELQ GPRPTPLRI KDSHKIKK Sbjct: 36 NMDQFSHI-PTERSPRRELQLQGPRPTPLRISKDSHKIKK 74