BLASTX nr result
ID: Glycyrrhiza30_contig00024965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00024965 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP54699.1 Membrin-11, partial [Cajanus cajan] 67 4e-11 XP_004491283.1 PREDICTED: membrin-11-like [Cicer arietinum] 66 9e-11 ACJ84121.1 unknown [Medicago truncatula] AFK45862.1 unknown [Med... 65 1e-10 XP_003617337.1 Bos1/membrin family Qb-SNARE protein [Medicago tr... 65 1e-10 XP_014520278.1 PREDICTED: membrin-11-like [Vigna radiata var. ra... 65 1e-10 XP_014517623.1 PREDICTED: membrin-11-like [Vigna radiata var. ra... 65 1e-10 XP_017435163.1 PREDICTED: membrin-11-like [Vigna angularis] KOM5... 65 1e-10 XP_017426544.1 PREDICTED: membrin-11-like [Vigna angularis] KOM4... 65 1e-10 XP_007146277.1 hypothetical protein PHAVU_006G027100g [Phaseolus... 65 1e-10 KHN28543.1 Membrin-11 [Glycine soja] 65 1e-10 KHM99672.1 Membrin-11 [Glycine soja] KRH45986.1 hypothetical pro... 65 1e-10 NP_001242121.1 uncharacterized protein LOC100803902 [Glycine max... 65 1e-10 GAU22187.1 hypothetical protein TSUD_252150, partial [Trifolium ... 63 1e-09 XP_013459631.1 Bos1/membrin family Qb-SNARE protein [Medicago tr... 63 1e-09 XP_013459630.1 Bos1/membrin family Qb-SNARE protein [Medicago tr... 63 1e-09 XP_013459629.1 Bos1/membrin family Qb-SNARE protein [Medicago tr... 63 1e-09 AFK34555.1 unknown [Medicago truncatula] 63 1e-09 XP_008342388.1 PREDICTED: membrin-11-like [Malus domestica] XP_0... 62 2e-09 XP_004499530.1 PREDICTED: membrin-11-like [Cicer arietinum] 62 4e-09 XP_004291595.1 PREDICTED: membrin-11-like [Fragaria vesca subsp.... 61 7e-09 >KYP54699.1 Membrin-11, partial [Cajanus cajan] Length = 274 Score = 67.4 bits (163), Expect = 4e-11 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 224 VVSMEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 V +MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 VAAMEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 37 >XP_004491283.1 PREDICTED: membrin-11-like [Cicer arietinum] Length = 223 Score = 65.9 bits (159), Expect = 9e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQ+ARKLLL+TRDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQTARKLLLKTRDGLERLERLEY 34 >ACJ84121.1 unknown [Medicago truncatula] AFK45862.1 unknown [Medicago truncatula] Length = 222 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGT SEIHQ+ARKLLLRTRDGLERLERLE+ Sbjct: 1 MEGGGGTFSEIHQTARKLLLRTRDGLERLERLEY 34 >XP_003617337.1 Bos1/membrin family Qb-SNARE protein [Medicago truncatula] AET00296.1 Bos1/membrin family Qb-SNARE protein [Medicago truncatula] Length = 222 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGT SEIHQ+ARKLLLRTRDGLERLERLE+ Sbjct: 1 MEGGGGTFSEIHQTARKLLLRTRDGLERLERLEY 34 >XP_014520278.1 PREDICTED: membrin-11-like [Vigna radiata var. radiata] Length = 225 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 34 >XP_014517623.1 PREDICTED: membrin-11-like [Vigna radiata var. radiata] Length = 225 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 34 >XP_017435163.1 PREDICTED: membrin-11-like [Vigna angularis] KOM52173.1 hypothetical protein LR48_Vigan09g083200 [Vigna angularis] BAT88784.1 hypothetical protein VIGAN_05239200 [Vigna angularis var. angularis] Length = 225 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 34 >XP_017426544.1 PREDICTED: membrin-11-like [Vigna angularis] KOM44794.1 hypothetical protein LR48_Vigan06g010000 [Vigna angularis] BAU00458.1 hypothetical protein VIGAN_10205700 [Vigna angularis var. angularis] Length = 225 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 34 >XP_007146277.1 hypothetical protein PHAVU_006G027100g [Phaseolus vulgaris] ESW18271.1 hypothetical protein PHAVU_006G027100g [Phaseolus vulgaris] Length = 225 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 34 >KHN28543.1 Membrin-11 [Glycine soja] Length = 228 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 34 >KHM99672.1 Membrin-11 [Glycine soja] KRH45986.1 hypothetical protein GLYMA_08G304700 [Glycine max] Length = 228 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 34 >NP_001242121.1 uncharacterized protein LOC100803902 [Glycine max] ACU18821.1 unknown [Glycine max] Length = 228 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQSA+KLLLR+RDGLERLERLE+ Sbjct: 1 MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEY 34 >GAU22187.1 hypothetical protein TSUD_252150, partial [Trifolium subterraneum] Length = 226 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 233 MEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 MEGGGGTLSEIHQ+ARKLLLRTR+GLERLER E+ Sbjct: 1 MEGGGGTLSEIHQTARKLLLRTREGLERLERQEY 34 >XP_013459631.1 Bos1/membrin family Qb-SNARE protein [Medicago truncatula] KEH33662.1 Bos1/membrin family Qb-SNARE protein [Medicago truncatula] Length = 210 Score = 62.8 bits (151), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 239 GGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 GGGGTLSE+HQSA+KLLLR RDGLERLERLEH Sbjct: 5 GGGGTLSEVHQSAKKLLLRCRDGLERLERLEH 36 >XP_013459630.1 Bos1/membrin family Qb-SNARE protein [Medicago truncatula] KEH33661.1 Bos1/membrin family Qb-SNARE protein [Medicago truncatula] Length = 215 Score = 62.8 bits (151), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 239 GGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 GGGGTLSE+HQSA+KLLLR RDGLERLERLEH Sbjct: 5 GGGGTLSEVHQSAKKLLLRCRDGLERLERLEH 36 >XP_013459629.1 Bos1/membrin family Qb-SNARE protein [Medicago truncatula] KEH33660.1 Bos1/membrin family Qb-SNARE protein [Medicago truncatula] Length = 230 Score = 62.8 bits (151), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 239 GGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 GGGGTLSE+HQSA+KLLLR RDGLERLERLEH Sbjct: 5 GGGGTLSEVHQSAKKLLLRCRDGLERLERLEH 36 >AFK34555.1 unknown [Medicago truncatula] Length = 230 Score = 62.8 bits (151), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 239 GGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 GGGGTLSE+HQSA+KLLLR RDGLERLERLEH Sbjct: 5 GGGGTLSEVHQSAKKLLLRCRDGLERLERLEH 36 >XP_008342388.1 PREDICTED: membrin-11-like [Malus domestica] XP_009375872.1 PREDICTED: membrin-11-like [Pyrus x bretschneideri] Length = 227 Score = 62.4 bits (150), Expect = 2e-09 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 227 VSMEGGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 +S+E GGGTLSEI+QSA+K+LLRTRDGLERLERLEH Sbjct: 3 LSVELGGGTLSEIYQSAKKVLLRTRDGLERLERLEH 38 >XP_004499530.1 PREDICTED: membrin-11-like [Cicer arietinum] Length = 229 Score = 61.6 bits (148), Expect = 4e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 239 GGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 GGGGTLSE+HQ+A+KLLLR RDGLERLERLEH Sbjct: 4 GGGGTLSEVHQNAKKLLLRCRDGLERLERLEH 35 >XP_004291595.1 PREDICTED: membrin-11-like [Fragaria vesca subsp. vesca] Length = 225 Score = 60.8 bits (146), Expect = 7e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 239 GGGGTLSEIHQSARKLLLRTRDGLERLERLEH 334 GGGGTLSEI+QSA+KLLLRTRDGLERLERLE+ Sbjct: 6 GGGGTLSEIYQSAKKLLLRTRDGLERLERLEY 37