BLASTX nr result
ID: Glycyrrhiza30_contig00024829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00024829 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012571293.1 PREDICTED: putative pentatricopeptide repeat-cont... 122 7e-31 XP_013459888.1 pentatricopeptide (PPR) repeat protein [Medicago ... 111 1e-26 XP_015966122.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 2e-20 XP_019464912.1 PREDICTED: putative pentatricopeptide repeat-cont... 92 8e-20 XP_014629134.1 PREDICTED: putative pentatricopeptide repeat-cont... 91 1e-19 KRH75048.1 hypothetical protein GLYMA_01G059000 [Glycine max] 91 1e-19 KYP50144.1 Pentatricopeptide repeat-containing protein At1g62910... 90 5e-19 XP_006573154.1 PREDICTED: putative pentatricopeptide repeat-cont... 89 7e-19 XP_016203976.1 PREDICTED: putative pentatricopeptide repeat-cont... 89 9e-19 XP_016200436.1 PREDICTED: putative pentatricopeptide repeat-cont... 88 2e-18 XP_015966106.1 PREDICTED: putative pentatricopeptide repeat-cont... 87 3e-18 KYP31404.1 hypothetical protein KK1_048306 [Cajanus cajan] 87 4e-18 XP_016204039.1 PREDICTED: putative pentatricopeptide repeat-cont... 87 4e-18 XP_016204033.1 PREDICTED: putative pentatricopeptide repeat-cont... 87 6e-18 XP_015966103.1 PREDICTED: putative pentatricopeptide repeat-cont... 86 8e-18 XP_015966101.1 PREDICTED: putative pentatricopeptide repeat-cont... 86 8e-18 XP_016204025.1 PREDICTED: putative pentatricopeptide repeat-cont... 86 2e-17 XP_015965999.1 PREDICTED: putative pentatricopeptide repeat-cont... 86 2e-17 XP_016204038.1 PREDICTED: putative pentatricopeptide repeat-cont... 85 2e-17 XP_014629135.1 PREDICTED: putative pentatricopeptide repeat-cont... 85 3e-17 >XP_012571293.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Cicer arietinum] Length = 508 Score = 122 bits (306), Expect = 7e-31 Identities = 62/89 (69%), Positives = 72/89 (80%), Gaps = 1/89 (1%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 SS+ +N+NAV N+P +RT LLNSI++L DV+ AVT FH+M M PFP VKDFNFLFTF+ Sbjct: 25 SSSTTNSNAVNNNPINRTHLLNSIKTLPDVNAAVTFFHQMLTMNPFPNVKDFNFLFTFIT 84 Query: 184 -KTKRYTRAISLIKHAHSLGVGADTYTLN 267 KTK YT AISLIKHAHSLGV DTYTLN Sbjct: 85 KKTKHYTTAISLIKHAHSLGVKPDTYTLN 113 >XP_013459888.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH33919.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 587 Score = 111 bits (277), Expect = 1e-26 Identities = 53/89 (59%), Positives = 69/89 (77%), Gaps = 1/89 (1%) Frame = +1 Query: 4 SSTHSNNNAVINDP-RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFV 180 S+ H ++NAV ++P +RT LLN+IR+L++V+ AVT FH+M +KP P +KDFN LFTF+ Sbjct: 23 SNLHFSSNAVNSNPTNTRTHLLNTIRTLTNVNTAVTFFHQMLTLKPLPNIKDFNLLFTFI 82 Query: 181 AKTKRYTRAISLIKHAHSLGVGADTYTLN 267 KTK YT ISLIKHAHS + ADTYTLN Sbjct: 83 TKTKNYTTTISLIKHAHSFNINADTYTLN 111 >XP_015966122.1 PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like, partial [Arachis duranensis] Length = 1180 Score = 93.6 bits (231), Expect = 2e-20 Identities = 50/88 (56%), Positives = 62/88 (70%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 SSTH I+ + RT L+NSIR+L ++D A+ LF +M +M P PCVKDFN LF VA Sbjct: 7 SSTH------IHAIKDRTYLINSIRNLQNLDPALHLFQQMLSMNPLPCVKDFNLLFGSVA 60 Query: 184 KTKRYTRAISLIKHAHSLGVGADTYTLN 267 K K YT AISLIKH SLGV +DT+TL+ Sbjct: 61 KMKHYTVAISLIKHVFSLGVKSDTFTLS 88 Score = 82.0 bits (201), Expect = 3e-16 Identities = 39/74 (52%), Positives = 53/74 (71%) Frame = +1 Query: 46 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 225 + R L++SIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K K YT AISLIK+ Sbjct: 630 KDRPLLVDSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLFSSIVKMKHYTAAISLIKY 689 Query: 226 AHSLGVGADTYTLN 267 SL + +D YTLN Sbjct: 690 LFSLRLKSDIYTLN 703 >XP_019464912.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Lupinus angustifolius] Length = 609 Score = 92.0 bits (227), Expect = 8e-20 Identities = 48/88 (54%), Positives = 58/88 (65%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 SS +++ +IN RT LLNSIR+L +VD A FHEM ++ P P VKDFN LF F+ Sbjct: 47 SSIEIHHDTIIN----RTHLLNSIRNLKNVDTAFNFFHEMVSINPLPSVKDFNLLFGFIV 102 Query: 184 KTKRYTRAISLIKHAHSLGVGADTYTLN 267 K K YT ISLIKH +SLGV D TLN Sbjct: 103 KMKHYTTTISLIKHLYSLGVRPDVCTLN 130 >XP_014629134.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] Length = 583 Score = 91.3 bits (225), Expect = 1e-19 Identities = 47/88 (53%), Positives = 59/88 (67%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 S H++NNA IN R+ Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 45 SDNHNHNNASINTRRA--QFLDSMRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 102 Query: 184 KTKRYTRAISLIKHAHSLGVGADTYTLN 267 K K YT AISLIKH +GV + T N Sbjct: 103 KMKHYTTAISLIKHMSYIGVKPNVSTHN 130 >KRH75048.1 hypothetical protein GLYMA_01G059000 [Glycine max] Length = 608 Score = 91.3 bits (225), Expect = 1e-19 Identities = 47/88 (53%), Positives = 59/88 (67%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 S H++NNA IN R+ Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 45 SDNHNHNNASINTRRA--QFLDSMRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 102 Query: 184 KTKRYTRAISLIKHAHSLGVGADTYTLN 267 K K YT AISLIKH +GV + T N Sbjct: 103 KMKHYTTAISLIKHMSYIGVKPNVSTHN 130 >KYP50144.1 Pentatricopeptide repeat-containing protein At1g62910 family [Cajanus cajan] Length = 519 Score = 89.7 bits (221), Expect = 5e-19 Identities = 44/72 (61%), Positives = 53/72 (73%) Frame = +1 Query: 52 RTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKHAH 231 RT+LL SIR++ +VD A+ LFH+M AMKPFP KDFN L + +AK K YT ISL KH + Sbjct: 62 RTKLLVSIRNIRNVDTALDLFHQMIAMKPFPSNKDFNLLLSIIAKMKHYTTVISLTKHMY 121 Query: 232 SLGVGADTYTLN 267 SLGV D YTLN Sbjct: 122 SLGVKPDVYTLN 133 >XP_006573154.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_003517841.2 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_014629146.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] KRH75063.1 hypothetical protein GLYMA_01G059900 [Glycine max] Length = 604 Score = 89.4 bits (220), Expect = 7e-19 Identities = 45/88 (51%), Positives = 57/88 (64%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 S + S + V + SR Q L+S+R+ VD A+ +H+M MKPFPCVKDFN LF+ VA Sbjct: 39 SHSSSTFSFVSDSDTSRAQFLDSMRNAKSVDVALDFYHKMVTMKPFPCVKDFNLLFSIVA 98 Query: 184 KTKRYTRAISLIKHAHSLGVGADTYTLN 267 K K YT AISLIKH +GV +TLN Sbjct: 99 KMKHYTTAISLIKHMSYIGVKPTVHTLN 126 >XP_016203976.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 597 Score = 89.0 bits (219), Expect = 9e-19 Identities = 42/74 (56%), Positives = 55/74 (74%) Frame = +1 Query: 46 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 225 + RT L+NSIR+L ++D A+ LF +M +M P PCVKDFN LF + K K YT AISLIKH Sbjct: 44 KDRTYLINSIRNLQNLDPALHLFQQMLSMNPLPCVKDFNLLFGSIVKMKHYTVAISLIKH 103 Query: 226 AHSLGVGADTYTLN 267 SLG+ +DT+TL+ Sbjct: 104 VFSLGLKSDTFTLS 117 >XP_016200436.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 600 Score = 88.2 bits (217), Expect = 2e-18 Identities = 48/91 (52%), Positives = 59/91 (64%), Gaps = 7/91 (7%) Frame = +1 Query: 16 SNNNAVINDPR-------SRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFT 174 S++N +D R +RTQLLNSIR+L +VD A LFH+M +M P P KDFN LF Sbjct: 34 SSSNYCTHDSRIGVHKTVNRTQLLNSIRNLKNVDSAFNLFHKMVSMNPLPSEKDFNLLFG 93 Query: 175 FVAKTKRYTRAISLIKHAHSLGVGADTYTLN 267 F+ + K YT AISLIKH SLGV + TLN Sbjct: 94 FIVRMKDYTTAISLIKHMCSLGVCVNVCTLN 124 >XP_015966106.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis duranensis] Length = 587 Score = 87.4 bits (215), Expect = 3e-18 Identities = 43/86 (50%), Positives = 58/86 (67%) Frame = +1 Query: 10 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 189 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFL + + K Sbjct: 22 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLCSSIVKM 81 Query: 190 KRYTRAISLIKHAHSLGVGADTYTLN 267 K YT AISLIKH SLG+ +D YTLN Sbjct: 82 KHYTSAISLIKHLFSLGLKSDIYTLN 107 >KYP31404.1 hypothetical protein KK1_048306 [Cajanus cajan] Length = 586 Score = 87.0 bits (214), Expect = 4e-18 Identities = 44/86 (51%), Positives = 57/86 (66%) Frame = +1 Query: 7 STHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAK 186 S+ + + V RT+LL SIR++ +VD A+ LFH+M AMKPFP KDFN L + +AK Sbjct: 26 SSSTFSTLVSGSDTRRTKLLGSIRNIRNVDTALDLFHQMIAMKPFPSNKDFNLLLSIIAK 85 Query: 187 TKRYTRAISLIKHAHSLGVGADTYTL 264 K YT ISL KH +SLGV D +TL Sbjct: 86 MKHYTTVISLTKHMYSLGVKPDVHTL 111 >XP_016204039.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 587 Score = 87.0 bits (214), Expect = 4e-18 Identities = 43/86 (50%), Positives = 58/86 (67%) Frame = +1 Query: 10 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 189 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K Sbjct: 22 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMLSMNPLPCVNDFNFLFSSIVKM 81 Query: 190 KRYTRAISLIKHAHSLGVGADTYTLN 267 K YT AISLIKH SL + +D YTLN Sbjct: 82 KHYTAAISLIKHLFSLRLKSDIYTLN 107 >XP_016204033.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Arachis ipaensis] Length = 600 Score = 86.7 bits (213), Expect = 6e-18 Identities = 41/78 (52%), Positives = 56/78 (71%) Frame = +1 Query: 34 INDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAIS 213 I+ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K K YT AIS Sbjct: 43 IDTIKDRPHLVNSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLFSSIVKMKHYTAAIS 102 Query: 214 LIKHAHSLGVGADTYTLN 267 LIKH SLG+ ++ YTL+ Sbjct: 103 LIKHLFSLGLKSNIYTLS 120 >XP_015966103.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Arachis duranensis] XP_015966104.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Arachis duranensis] Length = 600 Score = 86.3 bits (212), Expect = 8e-18 Identities = 40/74 (54%), Positives = 54/74 (72%) Frame = +1 Query: 46 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 225 + R L++SIR+L ++D A+ LFH+M +M P PCV DFNFLF+ + K K YT AISLIK+ Sbjct: 47 KDRPHLVDSIRNLQNLDSALHLFHKMVSMNPLPCVNDFNFLFSSIVKMKHYTAAISLIKY 106 Query: 226 AHSLGVGADTYTLN 267 SL + +D YTLN Sbjct: 107 LFSLRLKSDIYTLN 120 >XP_015966101.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Arachis duranensis] Length = 600 Score = 86.3 bits (212), Expect = 8e-18 Identities = 40/74 (54%), Positives = 53/74 (71%) Frame = +1 Query: 46 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 225 + R+ L+NSIR+L ++D A+ LF +M +M P PCV DFN LF+ + K K YT A+SLIKH Sbjct: 47 KDRSHLVNSIRNLQNLDSALHLFDKMLSMNPLPCVNDFNLLFSSIVKMKHYTAAMSLIKH 106 Query: 226 AHSLGVGADTYTLN 267 SLG +D YTLN Sbjct: 107 LFSLGFKSDIYTLN 120 >XP_016204025.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 598 Score = 85.5 bits (210), Expect = 2e-17 Identities = 40/74 (54%), Positives = 55/74 (74%) Frame = +1 Query: 46 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 225 + RT+L++SIR+L ++D A+ LFH+M +M P P VKDF LF+ + K K YT AISLIKH Sbjct: 45 KDRTRLIDSIRNLQNLDSALHLFHKMVSMNPLPSVKDFTLLFSSMVKMKHYTAAISLIKH 104 Query: 226 AHSLGVGADTYTLN 267 SLG+ +D YTL+ Sbjct: 105 LFSLGLKSDIYTLS 118 >XP_015965999.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis duranensis] Length = 600 Score = 85.5 bits (210), Expect = 2e-17 Identities = 47/96 (48%), Positives = 60/96 (62%), Gaps = 7/96 (7%) Frame = +1 Query: 1 FSSTHSNNNAVINDPR-------SRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDF 159 ++ S++N +D R +RTQLLNSIR+L +VD A LF +M +M P P KDF Sbjct: 29 YNLAFSSSNYCTHDSRIGVHKTVNRTQLLNSIRNLKNVDSAFNLFRKMVSMNPLPSEKDF 88 Query: 160 NFLFTFVAKTKRYTRAISLIKHAHSLGVGADTYTLN 267 N LF F+ + K YT AISLIKH SLGV + TLN Sbjct: 89 NLLFGFIVRMKDYTTAISLIKHMCSLGVCVNVCTLN 124 >XP_016204038.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 589 Score = 85.1 bits (209), Expect = 2e-17 Identities = 42/86 (48%), Positives = 58/86 (67%) Frame = +1 Query: 10 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 189 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K Sbjct: 24 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMLSMNPLPCVNDFNFLFSSIVKM 83 Query: 190 KRYTRAISLIKHAHSLGVGADTYTLN 267 K YT AISLIKH SL + +D YTL+ Sbjct: 84 KHYTAAISLIKHLFSLRLKSDIYTLS 109 >XP_014629135.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_014629136.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] KRH75044.1 hypothetical protein GLYMA_01G058700 [Glycine max] KRH75045.1 hypothetical protein GLYMA_01G058700 [Glycine max] Length = 597 Score = 84.7 bits (208), Expect = 3e-17 Identities = 46/88 (52%), Positives = 57/88 (64%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 SS+ + A IN SR Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 34 SSSTFSTYASINT--SRAQFLDSLRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 91 Query: 184 KTKRYTRAISLIKHAHSLGVGADTYTLN 267 K K YT AISLIKH +GV + T N Sbjct: 92 KMKHYTTAISLIKHMSYIGVKPNVPTHN 119