BLASTX nr result
ID: Glycyrrhiza30_contig00024412
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00024412 (478 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN33577.1 hypothetical protein glysoja_005619 [Glycine soja] 62 4e-10 CDO97366.1 unnamed protein product [Coffea canephora] 53 4e-06 >KHN33577.1 hypothetical protein glysoja_005619 [Glycine soja] Length = 45 Score = 61.6 bits (148), Expect = 4e-10 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 328 DFLHYGSMKSVIERYNKLKEEHHQLLNTASEVK 230 DFLHY SMKSVIERYNKLKEEHH L+N ASE K Sbjct: 8 DFLHYDSMKSVIERYNKLKEEHHHLMNPASEAK 40 >CDO97366.1 unnamed protein product [Coffea canephora] Length = 102 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 310 SMKSVIERYNKLKEEHHQLLNTASEVKVITSTPSS 206 SMKS+IERYN++KEEHH+LLN ASE+KV + SS Sbjct: 61 SMKSIIERYNRMKEEHHRLLNPASEIKVTFTKHSS 95