BLASTX nr result
ID: Glycyrrhiza30_contig00024288
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00024288 (210 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014621065.1 PREDICTED: zinc finger BED domain-containing prot... 81 2e-16 KHN03605.1 Putative AC transposase [Glycine soja] 81 2e-16 XP_004493926.1 PREDICTED: zinc finger BED domain-containing prot... 79 1e-15 KHN15060.1 Putative AC transposase [Glycine soja] 78 4e-15 KHN22127.1 hypothetical protein glysoja_033441 [Glycine soja] 77 4e-15 XP_014625130.1 PREDICTED: zinc finger BED domain-containing prot... 77 5e-15 XP_014621068.1 PREDICTED: zinc finger BED domain-containing prot... 77 7e-15 GAU23059.1 hypothetical protein TSUD_337070 [Trifolium subterran... 75 4e-14 KRH03660.1 hypothetical protein GLYMA_17G111700 [Glycine max] 72 5e-13 XP_012573510.1 PREDICTED: zinc finger BED domain-containing prot... 68 9e-12 XP_012573509.1 PREDICTED: zinc finger BED domain-containing prot... 68 9e-12 XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus... 67 2e-11 XP_014508793.1 PREDICTED: zinc finger BED domain-containing prot... 65 8e-11 XP_017437935.1 PREDICTED: zinc finger BED domain-containing prot... 65 1e-10 GAU11872.1 hypothetical protein TSUD_194950 [Trifolium subterran... 62 1e-09 OIV93529.1 hypothetical protein TanjilG_28686 [Lupinus angustifo... 59 2e-08 KRH38718.1 hypothetical protein GLYMA_09G153400 [Glycine max] 59 2e-08 XP_019423511.1 PREDICTED: zinc finger BED domain-containing prot... 59 2e-08 XP_019423508.1 PREDICTED: zinc finger BED domain-containing prot... 59 2e-08 KHN24413.1 Putative AC transposase [Glycine soja] 58 4e-08 >XP_014621065.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621066.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621067.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20154.1 hypothetical protein GLYMA_13G160000 [Glycine max] Length = 1180 Score = 81.3 bits (199), Expect = 2e-16 Identities = 41/69 (59%), Positives = 51/69 (73%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHS 28 S+ TLD++P EAPPS Q+VNSE L NN V+ SE QTSN+VV+SETQ +E V+SETQ S Sbjct: 172 SEATLDQQPKSEAPPSNQLVNSETLPNNGVLRSEHQTSNEVVISETQQSNEAVLSETQES 231 Query: 27 DGGVFASET 1 + SET Sbjct: 232 NEEAVLSET 240 >KHN03605.1 Putative AC transposase [Glycine soja] Length = 1180 Score = 81.3 bits (199), Expect = 2e-16 Identities = 41/69 (59%), Positives = 51/69 (73%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHS 28 S+ TLD++P EAPPS Q+VNSE L NN V+ SE QTSN+VV+SETQ +E V+SETQ S Sbjct: 172 SEATLDQQPKSEAPPSNQLVNSETLPNNGVLRSEHQTSNEVVISETQQSNEAVLSETQES 231 Query: 27 DGGVFASET 1 + SET Sbjct: 232 NEEAVLSET 240 >XP_004493926.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_004493927.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_012569418.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_012569419.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] Length = 1274 Score = 79.0 bits (193), Expect = 1e-15 Identities = 44/70 (62%), Positives = 50/70 (71%) Frame = -1 Query: 210 GSDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQH 31 GS+ TLDKK AP+APP Q+V+ EAL N VNSEM TSN+VVVSET N + VV SETQ Sbjct: 159 GSEATLDKKSAPDAPPRNQLVDYEALPNIGEVNSEMHTSNEVVVSETHNNEGVVASETQQ 218 Query: 30 SDGGVFASET 1 D V SET Sbjct: 219 RD-EVVESET 227 >KHN15060.1 Putative AC transposase [Glycine soja] Length = 1154 Score = 77.8 bits (190), Expect = 4e-15 Identities = 43/69 (62%), Positives = 53/69 (76%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHS 28 S+ TL++KPA EAPPS Q++NSE L NN V++SE Q+S+DVVVSETQ EVV+SETQ S Sbjct: 135 SEATLEQKPASEAPPSNQLLNSETLPNNGVLHSEHQSSDDVVVSETQQSYEVVLSETQQS 194 Query: 27 DGGVFASET 1 V SET Sbjct: 195 H-EVVLSET 202 >KHN22127.1 hypothetical protein glysoja_033441 [Glycine soja] Length = 336 Score = 77.0 bits (188), Expect = 4e-15 Identities = 39/61 (63%), Positives = 48/61 (78%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHS 28 S+ TLD+KPA EAPPS Q+VNSE L++N VV+SE QTSNDV VSE Q +E V+ ETQ S Sbjct: 134 SEATLDQKPASEAPPSNQLVNSEILADNGVVHSEHQTSNDVAVSELQQSNEEVLPETQQS 193 Query: 27 D 25 + Sbjct: 194 N 194 >XP_014625130.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014625131.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH03658.1 hypothetical protein GLYMA_17G111500 [Glycine max] Length = 1154 Score = 77.4 bits (189), Expect = 5e-15 Identities = 39/60 (65%), Positives = 49/60 (81%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHS 28 S+ TL++KPA EAPPS Q++NSE L NN V++SE Q+S+DVVVSETQ EVV+SETQ S Sbjct: 135 SEATLEQKPASEAPPSNQLLNSETLPNNGVLHSEHQSSDDVVVSETQQSYEVVLSETQQS 194 >XP_014621068.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20149.1 hypothetical protein GLYMA_13G159800 [Glycine max] Length = 1100 Score = 77.0 bits (188), Expect = 7e-15 Identities = 39/61 (63%), Positives = 48/61 (78%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHS 28 S+ TLD+KPA EAPPS Q+VNSE L++N VV+SE QTSNDV VSE Q +E V+ ETQ S Sbjct: 134 SEATLDQKPASEAPPSNQLVNSEILADNGVVHSEHQTSNDVAVSELQQSNEEVLPETQQS 193 Query: 27 D 25 + Sbjct: 194 N 194 >GAU23059.1 hypothetical protein TSUD_337070 [Trifolium subterraneum] Length = 912 Score = 74.7 bits (182), Expect = 4e-14 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 13/82 (15%) Frame = -1 Query: 210 GSDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQ------------ 67 GS+ TLDK+ +PEA P+ QV++SEA+ +NSVVNSE+ SN VVVSETQ Sbjct: 160 GSEATLDKESSPEALPNNQVLDSEAMPDNSVVNSELHKSNGVVVSETQHNNDVVVVSETK 219 Query: 66 -NRDEVVVSETQHSDGGVFASE 4 N +++VVSE QH+D V SE Sbjct: 220 VNNEDLVVSEAQHNDEEVALSE 241 >KRH03660.1 hypothetical protein GLYMA_17G111700 [Glycine max] Length = 494 Score = 71.6 bits (174), Expect = 5e-13 Identities = 37/61 (60%), Positives = 47/61 (77%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHS 28 +DD + KPA EAPPS Q++N E L NN V++SE QTSNDVV+SETQ +EVV+ ETQ S Sbjct: 126 ADDNV--KPASEAPPSNQLLNFETLPNNGVLHSEHQTSNDVVLSETQQSNEVVLPETQQS 183 Query: 27 D 25 + Sbjct: 184 N 184 >XP_012573510.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573511.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573512.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] Length = 1058 Score = 68.2 bits (165), Expect = 9e-12 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDV-VVSETQNRDEVVVSETQH 31 S+ T D+K EA PS +NSEAL NN VVNSE+QTSN V V SETQ+ +EV +SETQH Sbjct: 142 SESTHDQKFVSEALPSNLPINSEALPNNGVVNSELQTSNGVDVGSETQHSNEVALSETQH 201 Query: 30 SDGGVFASET 1 S+ V SET Sbjct: 202 SN-EVALSET 210 >XP_012573509.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X1 [Cicer arietinum] Length = 1066 Score = 68.2 bits (165), Expect = 9e-12 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDV-VVSETQNRDEVVVSETQH 31 S+ T D+K EA PS +NSEAL NN VVNSE+QTSN V V SETQ+ +EV +SETQH Sbjct: 150 SESTHDQKFVSEALPSNLPINSEALPNNGVVNSELQTSNGVDVGSETQHSNEVALSETQH 209 Query: 30 SDGGVFASET 1 S+ V SET Sbjct: 210 SN-EVALSET 218 >XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] ESW27042.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] Length = 1252 Score = 67.0 bits (162), Expect = 2e-11 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHS 28 S+ +D+KP E+P + Q+VNSEAL +N VV+S QTSNDVVVSETQ +EVV+ E + + Sbjct: 138 SEAPVDQKPVSESPSNNQLVNSEALPSNGVVDSGHQTSNDVVVSETQRSNEVVLPEAEQN 197 Query: 27 D 25 + Sbjct: 198 N 198 Score = 53.9 bits (128), Expect = 1e-06 Identities = 31/59 (52%), Positives = 37/59 (62%) Frame = -1 Query: 177 PEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSETQHSDGGVFASET 1 PEA + +VV EA NN VV E ++VV+SETQ RDE V+SETQ D V SET Sbjct: 203 PEAEQNNEVVLPEAEQNNEVVLPETDQRDEVVISETQQRDEAVLSETQQGDEAVL-SET 260 >XP_014508793.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna radiata var. radiata] XP_014508794.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna radiata var. radiata] Length = 1233 Score = 65.5 bits (158), Expect = 8e-11 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSE 40 S+ LD+KP EAP S Q+V SE L +N VV++E QTSNDVVVSETQ+ +EVV + Sbjct: 137 SEAPLDQKPVSEAPSSDQLVTSETLPDNGVVDAEHQTSNDVVVSETQHSNEVVAEQ 192 >XP_017437935.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna angularis] KOM33000.1 hypothetical protein LR48_Vigan01g255600 [Vigna angularis] BAT76315.1 hypothetical protein VIGAN_01429700 [Vigna angularis var. angularis] Length = 1231 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSE 40 S+ LD+ P E P S Q+V SE L +N VV+SE QTSNDVVVSETQ+ DEVV + Sbjct: 137 SEAPLDQNPVSETPSSDQLVTSETLPDNGVVDSEHQTSNDVVVSETQHSDEVVAEQ 192 >GAU11872.1 hypothetical protein TSUD_194950 [Trifolium subterraneum] Length = 628 Score = 62.0 bits (149), Expect = 1e-09 Identities = 35/62 (56%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVVNSEMQTSN-DVVVSETQNRDEVVVSETQH 31 S+ T D+K A EAPPS +SEA NN VV SE+QTSN VVVSETQ+ +E+ + ETQ Sbjct: 114 SEATPDQKFASEAPPSNLPTDSEAFPNNGVVTSELQTSNGGVVVSETQHSNELALPETQQ 173 Query: 30 SD 25 S+ Sbjct: 174 SN 175 >OIV93529.1 hypothetical protein TanjilG_28686 [Lupinus angustifolius] Length = 448 Score = 58.5 bits (140), Expect = 2e-08 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 4/72 (5%) Frame = -1 Query: 204 DDTLDKKPAPE----APPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSET 37 D + K P+ + P+ Q+VNS+ L N NSEMQT N++VVSET+ DE+VVSET Sbjct: 137 DQLVSSKALPDHQTASEPNNQLVNSKVLPTNIADNSEMQTGNEMVVSETRQNDEIVVSET 196 Query: 36 QHSDGGVFASET 1 +D V SET Sbjct: 197 WQNDEMV-VSET 207 >KRH38718.1 hypothetical protein GLYMA_09G153400 [Glycine max] Length = 951 Score = 58.5 bits (140), Expect = 2e-08 Identities = 35/65 (53%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNN-SVVNSEMQTSNDVVVSETQNRDEVVVSETQH 31 S+ LD K + PS Q VN+EAL N+ +V NSE TSNDV+VSETQ+ DEVV+SET Sbjct: 137 SEAPLDMKASQ---PSNQQVNTEALPNHINVSNSETHTSNDVLVSETQHSDEVVMSETVQ 193 Query: 30 SDGGV 16 + G+ Sbjct: 194 GNEGI 198 >XP_019423511.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X2 [Lupinus angustifolius] Length = 1153 Score = 58.5 bits (140), Expect = 2e-08 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 4/72 (5%) Frame = -1 Query: 204 DDTLDKKPAPE----APPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSET 37 D + K P+ + P+ Q+VNS+ L N NSEMQT N++VVSET+ DE+VVSET Sbjct: 137 DQLVSSKALPDHQTASEPNNQLVNSKVLPTNIADNSEMQTGNEMVVSETRQNDEIVVSET 196 Query: 36 QHSDGGVFASET 1 +D V SET Sbjct: 197 WQNDEMV-VSET 207 >XP_019423508.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019423509.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019423510.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] Length = 1175 Score = 58.5 bits (140), Expect = 2e-08 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 4/72 (5%) Frame = -1 Query: 204 DDTLDKKPAPE----APPSTQVVNSEALSNNSVVNSEMQTSNDVVVSETQNRDEVVVSET 37 D + K P+ + P+ Q+VNS+ L N NSEMQT N++VVSET+ DE+VVSET Sbjct: 137 DQLVSSKALPDHQTASEPNNQLVNSKVLPTNIADNSEMQTGNEMVVSETRQNDEIVVSET 196 Query: 36 QHSDGGVFASET 1 +D V SET Sbjct: 197 WQNDEMV-VSET 207 >KHN24413.1 Putative AC transposase [Glycine soja] Length = 874 Score = 57.8 bits (138), Expect = 4e-08 Identities = 38/72 (52%), Positives = 47/72 (65%), Gaps = 3/72 (4%) Frame = -1 Query: 207 SDDTLDKKPAPEAPPSTQVVNSEALSNNSVV---NSEMQTSNDVVVSETQNRDEVVVSET 37 S+ LD K + PS Q VN+EAL N++ V NSE TSNDV+VSETQ+ DEVV SET Sbjct: 134 SEAPLDMK-MKASQPSNQQVNTEALPNHNNVGNCNSEKHTSNDVLVSETQHSDEVVTSET 192 Query: 36 QHSDGGVFASET 1 + G+ SET Sbjct: 193 VQGNEGII-SET 203