BLASTX nr result
ID: Glycyrrhiza30_contig00024270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00024270 (716 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO64726.1 hypothetical protein COLO4_31912 [Corchorus olitorius] 66 2e-10 >OMO64726.1 hypothetical protein COLO4_31912 [Corchorus olitorius] Length = 99 Score = 65.9 bits (159), Expect = 2e-10 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = -1 Query: 329 CKSHGQSQEVKAATPLHKAMEYETSIDGGIPSEERGPSTSTTFLCDVNFGSYKH---CP 162 C SHG+SQEVKAAT LHKAMEYET+ DGG P + F CDV FG YK CP Sbjct: 40 CTSHGRSQEVKAATLLHKAMEYETAHDGGAP-RRKDRQHRRAFFCDVIFGIYKQNTVCP 97