BLASTX nr result
ID: Glycyrrhiza30_contig00024051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00024051 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007160909.1 hypothetical protein PHAVU_001G027300g [Phaseolus... 55 4e-06 XP_014502563.1 PREDICTED: U-box domain-containing protein 4-like... 55 7e-06 XP_003550308.1 PREDICTED: U-box domain-containing protein 4 [Gly... 55 7e-06 XP_017428243.1 PREDICTED: U-box domain-containing protein 4 [Vig... 54 1e-05 >XP_007160909.1 hypothetical protein PHAVU_001G027300g [Phaseolus vulgaris] ESW32903.1 hypothetical protein PHAVU_001G027300g [Phaseolus vulgaris] Length = 351 Score = 55.5 bits (132), Expect = 4e-06 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 12/88 (13%) Frame = +1 Query: 4 HTSSIDD*KQASMEIRLLAKKKPKNRMKTAKASASAINPL--LIASGSFSPDSCGI---- 165 H++S+DD KQA+MEIRLLAK KP+NR+K AK A AI PL LI+S G+ Sbjct: 69 HSASLDDQKQAAMEIRLLAKNKPENRLKIAK--AGAIKPLISLISSSDLQLQEYGVTAIL 126 Query: 166 -----HKKKDATTTPGS-KGLVSAYARG 231 + K+A + G+ K LV A + G Sbjct: 127 NLSLCDENKEAIASSGAIKPLVRALSTG 154 >XP_014502563.1 PREDICTED: U-box domain-containing protein 4-like [Vigna radiata var. radiata] Length = 351 Score = 54.7 bits (130), Expect = 7e-06 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 12/88 (13%) Frame = +1 Query: 4 HTSSIDD*KQASMEIRLLAKKKPKNRMKTAKASASAINPL--LIASGSFSPDSCGI---- 165 H++S+DD KQA+MEIRLLAK KP+NR+K AK A AI PL LI+S G+ Sbjct: 69 HSASLDDQKQAAMEIRLLAKNKPENRLKIAK--AGAIKPLISLISSTDLQLQEYGVTAIL 126 Query: 166 -----HKKKDATTTPGS-KGLVSAYARG 231 + K+A + G+ K LV A + G Sbjct: 127 NLSLCDENKEAIASAGAIKPLVRALSTG 154 >XP_003550308.1 PREDICTED: U-box domain-containing protein 4 [Glycine max] KRH05594.1 hypothetical protein GLYMA_17G235600 [Glycine max] Length = 352 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 4 HTSSIDD*KQASMEIRLLAKKKPKNRMKTAKASASAINPLL 126 H+SSIDD KQA+MEIRLLAK KP+NR+K AK A AI PL+ Sbjct: 69 HSSSIDDQKQAAMEIRLLAKNKPENRIKIAK--AGAIKPLI 107 >XP_017428243.1 PREDICTED: U-box domain-containing protein 4 [Vigna angularis] KOM48947.1 hypothetical protein LR48_Vigan07g265100 [Vigna angularis] BAT82592.1 hypothetical protein VIGAN_03263200 [Vigna angularis var. angularis] Length = 351 Score = 54.3 bits (129), Expect = 1e-05 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 12/88 (13%) Frame = +1 Query: 4 HTSSIDD*KQASMEIRLLAKKKPKNRMKTAKASASAINPL--LIASGSFSPDSCGI---- 165 H++S+DD KQA+MEIRLLAK KP+NR+K AK A AI PL LI+S G+ Sbjct: 69 HSASLDDQKQAAMEIRLLAKNKPENRVKIAK--AGAIKPLISLISSPDLQLQEYGVTAIL 126 Query: 166 -----HKKKDATTTPGS-KGLVSAYARG 231 + K+A + G+ K LV A + G Sbjct: 127 NLSLCDENKEAIASAGAIKPLVRALSTG 154