BLASTX nr result
ID: Glycyrrhiza30_contig00023987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00023987 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013461109.1 disease resistance protein (TIR-NBS-LRR class), p... 74 2e-13 XP_003601415.2 toll-interleukin-resistance (TIR) domain protein,... 64 6e-10 >XP_013461109.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] KEH35143.1 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1273 Score = 73.9 bits (180), Expect = 2e-13 Identities = 42/69 (60%), Positives = 47/69 (68%), Gaps = 3/69 (4%) Frame = -3 Query: 286 LDFKQHTTTNEATT-KVLKSHWIS-HETTLKVNTPQLRRN-HNTNVRQLLSFPTYRPPRR 116 L FK+ TNE T K+ KS WIS ++ LKVNTPQL N N V Q LSFP Y+PPRR Sbjct: 1203 LRFKKSAPTNETVTNKLFKSQWISSNDIVLKVNTPQLPDNPRNRKVSQRLSFPIYQPPRR 1262 Query: 115 LSSSQSHFC 89 LS SQSHFC Sbjct: 1263 LSFSQSHFC 1271 >XP_003601415.2 toll-interleukin-resistance (TIR) domain protein, putative [Medicago truncatula] AES71666.2 toll-interleukin-resistance (TIR) domain protein, putative [Medicago truncatula] Length = 1193 Score = 64.3 bits (155), Expect = 6e-10 Identities = 39/71 (54%), Positives = 47/71 (66%), Gaps = 4/71 (5%) Frame = -3 Query: 286 LDFKQHTTTNEATTK-VLKSHWIS-HETTLKVNTPQLRRNH-NTNVRQLLSFPTYRPPRR 116 L FK+ TTT E T +LKSHWIS ++ LKVNT QL+ H N NVRQ L PTY+PPRR Sbjct: 520 LRFKKPTTTIETITNTILKSHWISSNDIVLKVNTLQLQHIHRNRNVRQRLPCPTYQPPRR 579 Query: 115 -LSSSQSHFCS 86 +H+CS Sbjct: 580 CFDFKLAHYCS 590