BLASTX nr result
ID: Glycyrrhiza30_contig00023859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00023859 (333 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP77543.1 hypothetical protein KK1_049123, partial [Cajanus cajan] 84 2e-18 GAU48489.1 hypothetical protein TSUD_291740 [Trifolium subterran... 71 5e-12 KZN06896.1 hypothetical protein DCAR_007733 [Daucus carota subsp... 64 9e-10 OIV89892.1 hypothetical protein TanjilG_14030 [Lupinus angustifo... 57 2e-07 >KYP77543.1 hypothetical protein KK1_049123, partial [Cajanus cajan] Length = 135 Score = 84.0 bits (206), Expect = 2e-18 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 137 AIGCFAYLFYYGRLGDIRGRPSFLSGYDHSFIHSLNLGDNH 259 A+ CFAY F YGRLGDIRGRPSFLSGYDHSFIHSLNLGDNH Sbjct: 95 AVNCFAYRFDYGRLGDIRGRPSFLSGYDHSFIHSLNLGDNH 135 >GAU48489.1 hypothetical protein TSUD_291740 [Trifolium subterraneum] Length = 500 Score = 70.9 bits (172), Expect = 5e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 122 RLKQTAIGCFAYLFYYGRLGDIRGRPSFLSGYDHSFI 232 RLKQTAIGCFAYLFYYGRLGDIRGRPSFLSG H + Sbjct: 338 RLKQTAIGCFAYLFYYGRLGDIRGRPSFLSGTTHGAV 374 >KZN06896.1 hypothetical protein DCAR_007733 [Daucus carota subsp. sativus] Length = 649 Score = 64.3 bits (155), Expect = 9e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 113 SIDRLKQTAIGCFAYLFYYGRLGDIRGRPSFLSG 214 S++R +QTAIGCFAYLFYYGRLGDIRGRPS LSG Sbjct: 160 SLNRREQTAIGCFAYLFYYGRLGDIRGRPSSLSG 193 >OIV89892.1 hypothetical protein TanjilG_14030 [Lupinus angustifolius] Length = 285 Score = 57.4 bits (137), Expect = 2e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 110 LSIDRLKQTAIGCFAYLFYYGRLGDIRGRPSFLSG 214 LS D+ K AIGCFAYLFYYG LGDIRGRP+FLSG Sbjct: 84 LSRDKAKN-AIGCFAYLFYYGLLGDIRGRPTFLSG 117