BLASTX nr result
ID: Glycyrrhiza30_contig00023492
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00023492 (553 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001237001.1 uncharacterized protein LOC100499858 [Glycine max... 159 4e-47 KRH27112.1 hypothetical protein GLYMA_12G215000 [Glycine max] 155 7e-46 KYP47110.1 Thioredoxin-like 4 [Cajanus cajan] 155 8e-46 NP_001239956.1 uncharacterized protein LOC100813627 [Glycine max... 155 2e-45 XP_019436074.1 PREDICTED: thioredoxin-like protein CXXS1 [Lupinu... 153 7e-45 XP_007149691.1 hypothetical protein PHAVU_005G090900g [Phaseolus... 150 8e-44 XP_003596610.1 thioredoxin [Medicago truncatula] AES66861.1 thio... 148 6e-43 XP_013464804.1 thioredoxin [Medicago truncatula] KEH38839.1 thio... 148 8e-43 AFK37061.1 unknown [Medicago truncatula] 147 2e-42 XP_014522020.1 PREDICTED: thioredoxin-like protein CXXS1 isoform... 146 3e-42 XP_014522019.1 PREDICTED: thioredoxin-like protein CXXS1 isoform... 146 3e-42 XP_017424595.1 PREDICTED: thioredoxin-like protein CXXS1 isoform... 146 4e-42 XP_017424594.1 PREDICTED: thioredoxin-like protein CXXS1 isoform... 146 4e-42 KYP53466.1 Thioredoxin-like 4 [Cajanus cajan] 146 4e-42 XP_004487617.1 PREDICTED: thioredoxin-like protein CXXS1 [Cicer ... 143 1e-40 KHN47842.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH5561... 141 5e-40 NP_001237912.1 uncharacterized protein LOC100306379 [Glycine max... 141 5e-40 XP_016169198.1 PREDICTED: thioredoxin-like protein CXXS1 [Arachi... 139 2e-39 KRH33304.1 hypothetical protein GLYMA_10G114400 [Glycine max] 139 4e-39 XP_012091425.1 PREDICTED: thioredoxin-like protein CXXS1 [Jatrop... 138 5e-39 >NP_001237001.1 uncharacterized protein LOC100499858 [Glycine max] ACU13936.1 unknown [Glycine max] KHN36735.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH22228.1 hypothetical protein GLYMA_13G286600 [Glycine max] Length = 122 Score = 159 bits (401), Expect = 4e-47 Identities = 74/86 (86%), Positives = 82/86 (95%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 +VVHFSAFWCVPS+VMNPFFQ+LASTY +VLFLTLDVDEVKEIASK+EIKAMPTF+LL G Sbjct: 35 IVVHFSAFWCVPSLVMNPFFQELASTYEDVLFLTLDVDEVKEIASKMEIKAMPTFLLLSG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHST 258 G PVDKIVGANPDEIRKR+D F+HST Sbjct: 95 GTPVDKIVGANPDEIRKRIDHFVHST 120 >KRH27112.1 hypothetical protein GLYMA_12G215000 [Glycine max] Length = 100 Score = 155 bits (391), Expect = 7e-46 Identities = 73/86 (84%), Positives = 82/86 (95%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNPFFQ+LASTY +VLFLTLDVDEVKEIASK+EIKAMPTF+LL G Sbjct: 9 VVVHFSAFWCVPSIVMNPFFQELASTYEDVLFLTLDVDEVKEIASKMEIKAMPTFLLLSG 68 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHST 258 G P+DKIVGANPDEIRKR+D F++ST Sbjct: 69 GTPMDKIVGANPDEIRKRIDHFVNST 94 >KYP47110.1 Thioredoxin-like 4 [Cajanus cajan] Length = 123 Score = 155 bits (393), Expect = 8e-46 Identities = 75/85 (88%), Positives = 81/85 (95%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNPFFQ+LASTY++VLFLTLDVDEVKEIASK+EIKAMPTFVLL G Sbjct: 35 VVVHFSAFWCVPSIVMNPFFQELASTYQDVLFLTLDVDEVKEIASKMEIKAMPTFVLLSG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHS 255 G VDKIVGANPDEIRKR+D FIHS Sbjct: 95 GTTVDKIVGANPDEIRKRIDHFIHS 119 >NP_001239956.1 uncharacterized protein LOC100813627 [Glycine max] ACU24446.1 unknown [Glycine max] KHN27979.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH27111.1 hypothetical protein GLYMA_12G215000 [Glycine max] Length = 126 Score = 155 bits (391), Expect = 2e-45 Identities = 73/86 (84%), Positives = 82/86 (95%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNPFFQ+LASTY +VLFLTLDVDEVKEIASK+EIKAMPTF+LL G Sbjct: 35 VVVHFSAFWCVPSIVMNPFFQELASTYEDVLFLTLDVDEVKEIASKMEIKAMPTFLLLSG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHST 258 G P+DKIVGANPDEIRKR+D F++ST Sbjct: 95 GTPMDKIVGANPDEIRKRIDHFVNST 120 >XP_019436074.1 PREDICTED: thioredoxin-like protein CXXS1 [Lupinus angustifolius] Length = 126 Score = 153 bits (387), Expect = 7e-45 Identities = 72/86 (83%), Positives = 80/86 (93%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNPFF++LASTY+ FL LDVDEVKEIAS+LEIKAMPTF+LL G Sbjct: 35 VVVHFSAFWCVPSIVMNPFFEELASTYQKAKFLALDVDEVKEIASRLEIKAMPTFLLLSG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHST 258 GDPVDKIVGANPDE++KRVD FIHST Sbjct: 95 GDPVDKIVGANPDEVKKRVDHFIHST 120 >XP_007149691.1 hypothetical protein PHAVU_005G090900g [Phaseolus vulgaris] ESW21685.1 hypothetical protein PHAVU_005G090900g [Phaseolus vulgaris] Length = 126 Score = 150 bits (380), Expect = 8e-44 Identities = 70/87 (80%), Positives = 80/87 (91%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNP F++LASTY +VLFLTLDVDEVKEIASK+E+KAMPTF+LL G Sbjct: 35 VVVHFSAFWCVPSIVMNPVFEELASTYPDVLFLTLDVDEVKEIASKMEVKAMPTFLLLSG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHSTP 261 G PV+KIVGANPDEIRKR+D +HS P Sbjct: 95 GTPVEKIVGANPDEIRKRIDHLVHSNP 121 >XP_003596610.1 thioredoxin [Medicago truncatula] AES66861.1 thioredoxin [Medicago truncatula] Length = 122 Score = 148 bits (374), Expect = 6e-43 Identities = 72/87 (82%), Positives = 79/87 (90%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+ MNPFFQ+LAS Y++VLFLTLDVDEVKEIASK+EIKA+PTF+ L G Sbjct: 35 VVVHFSAFWCVPSIQMNPFFQELASNYQDVLFLTLDVDEVKEIASKMEIKAIPTFLFLNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHSTP 261 G VDKIVGANPDEIRKRVD FI STP Sbjct: 95 GTLVDKIVGANPDEIRKRVDHFIQSTP 121 >XP_013464804.1 thioredoxin [Medicago truncatula] KEH38839.1 thioredoxin [Medicago truncatula] Length = 135 Score = 148 bits (374), Expect = 8e-43 Identities = 72/87 (82%), Positives = 79/87 (90%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+ MNPFFQ+LAS Y++VLFLTLDVDEVKEIASK+EIKA+PTF+ L G Sbjct: 48 VVVHFSAFWCVPSIQMNPFFQELASNYQDVLFLTLDVDEVKEIASKMEIKAIPTFLFLNG 107 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHSTP 261 G VDKIVGANPDEIRKRVD FI STP Sbjct: 108 GTLVDKIVGANPDEIRKRVDHFIQSTP 134 >AFK37061.1 unknown [Medicago truncatula] Length = 122 Score = 147 bits (370), Expect = 2e-42 Identities = 71/87 (81%), Positives = 79/87 (90%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+ MNPFFQ+LAS Y++VLFLTLDVDEVKEIASK+EIKA+PTF+ L G Sbjct: 35 VVVHFSAFWCVPSIQMNPFFQELASNYQDVLFLTLDVDEVKEIASKMEIKAIPTFLFLNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHSTP 261 G VD+IVGANPDEIRKRVD FI STP Sbjct: 95 GTLVDEIVGANPDEIRKRVDHFIQSTP 121 >XP_014522020.1 PREDICTED: thioredoxin-like protein CXXS1 isoform X2 [Vigna radiata var. radiata] Length = 123 Score = 146 bits (369), Expect = 3e-42 Identities = 69/85 (81%), Positives = 79/85 (92%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNP F++LASTY++VLFLTLDVDEVKEIASK+EIKAMPTF+LL G Sbjct: 35 VVVHFSAFWCVPSIVMNPVFEELASTYQDVLFLTLDVDEVKEIASKMEIKAMPTFLLLNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHS 255 G PV+KIVGANPDEIRK +D F+ S Sbjct: 95 GTPVEKIVGANPDEIRKMIDHFVQS 119 >XP_014522019.1 PREDICTED: thioredoxin-like protein CXXS1 isoform X1 [Vigna radiata var. radiata] Length = 124 Score = 146 bits (369), Expect = 3e-42 Identities = 69/85 (81%), Positives = 79/85 (92%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNP F++LASTY++VLFLTLDVDEVKEIASK+EIKAMPTF+LL G Sbjct: 36 VVVHFSAFWCVPSIVMNPVFEELASTYQDVLFLTLDVDEVKEIASKMEIKAMPTFLLLNG 95 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHS 255 G PV+KIVGANPDEIRK +D F+ S Sbjct: 96 GTPVEKIVGANPDEIRKMIDHFVQS 120 >XP_017424595.1 PREDICTED: thioredoxin-like protein CXXS1 isoform X2 [Vigna angularis] KOM43854.1 hypothetical protein LR48_Vigan05g145900 [Vigna angularis] Length = 126 Score = 146 bits (369), Expect = 4e-42 Identities = 69/85 (81%), Positives = 79/85 (92%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNP F++LASTY++VLFLTLDVDEVKEIASK+EIKAMPTF+LL G Sbjct: 35 VVVHFSAFWCVPSIVMNPVFEELASTYQDVLFLTLDVDEVKEIASKMEIKAMPTFLLLNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHS 255 G PV+KIVGANPDEIRK +D F+ S Sbjct: 95 GTPVEKIVGANPDEIRKMIDHFVQS 119 >XP_017424594.1 PREDICTED: thioredoxin-like protein CXXS1 isoform X1 [Vigna angularis] BAT92428.1 hypothetical protein VIGAN_07113800 [Vigna angularis var. angularis] Length = 127 Score = 146 bits (369), Expect = 4e-42 Identities = 69/85 (81%), Positives = 79/85 (92%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNP F++LASTY++VLFLTLDVDEVKEIASK+EIKAMPTF+LL G Sbjct: 36 VVVHFSAFWCVPSIVMNPVFEELASTYQDVLFLTLDVDEVKEIASKMEIKAMPTFLLLNG 95 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHS 255 G PV+KIVGANPDEIRK +D F+ S Sbjct: 96 GTPVEKIVGANPDEIRKMIDHFVQS 120 >KYP53466.1 Thioredoxin-like 4 [Cajanus cajan] Length = 128 Score = 146 bits (369), Expect = 4e-42 Identities = 68/86 (79%), Positives = 79/86 (91%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 V+VHFSA+WCVPS+ MNPFFQ+LASTY+NVLFL +DVDEVKEI+SKLEIKA+PTFVL+ G Sbjct: 35 VMVHFSAYWCVPSIAMNPFFQELASTYQNVLFLNVDVDEVKEISSKLEIKAIPTFVLMNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHST 258 G PV+K VGANPDEIRKR+D FIH T Sbjct: 95 GAPVNKTVGANPDEIRKRIDCFIHQT 120 >XP_004487617.1 PREDICTED: thioredoxin-like protein CXXS1 [Cicer arietinum] Length = 130 Score = 143 bits (360), Expect = 1e-40 Identities = 69/86 (80%), Positives = 80/86 (93%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWCVPS+VMNPFFQ+LAS Y++VLFLTLDVDEVKEIASK+EIKA+PTF+LL G Sbjct: 35 VVVHFSAFWCVPSIVMNPFFQELASNYQDVLFLTLDVDEVKEIASKMEIKAIPTFLLLSG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHST 258 G VDKIVGANP EI+K+VD+FI S+ Sbjct: 95 GTHVDKIVGANPGEIKKKVDNFIISS 120 >KHN47842.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH55615.1 hypothetical protein GLYMA_06G266700 [Glycine max] Length = 126 Score = 141 bits (355), Expect = 5e-40 Identities = 65/84 (77%), Positives = 77/84 (91%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 V+VHFSA+WC+PS+ MN FFQQLASTY+NVLFL +DVDEVKE+ASKLEIKA+PTF L+ G Sbjct: 35 VMVHFSAYWCMPSIAMNHFFQQLASTYQNVLFLNVDVDEVKEVASKLEIKAIPTFCLMNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIH 252 G PVDKIVGANPDE+RKR++ FIH Sbjct: 95 GAPVDKIVGANPDELRKRINCFIH 118 >NP_001237912.1 uncharacterized protein LOC100306379 [Glycine max] ACU14521.1 unknown [Glycine max] Length = 126 Score = 141 bits (355), Expect = 5e-40 Identities = 65/84 (77%), Positives = 77/84 (91%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 V+VHFSA+WC+PS+ MN FFQQLASTY+NVLFL +DVDEVKE+ASKLEIKA+PTF L+ G Sbjct: 35 VMVHFSAYWCMPSIAMNHFFQQLASTYQNVLFLNVDVDEVKEVASKLEIKAIPTFCLMNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIH 252 G PVDKIVGANPDE+RKR++ FIH Sbjct: 95 GAPVDKIVGANPDELRKRINCFIH 118 >XP_016169198.1 PREDICTED: thioredoxin-like protein CXXS1 [Arachis ipaensis] XP_016169199.1 PREDICTED: thioredoxin-like protein CXXS1 [Arachis ipaensis] Length = 124 Score = 139 bits (351), Expect = 2e-39 Identities = 66/87 (75%), Positives = 74/87 (85%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 VVVHFSAFWC+ S +MNP F++LASTY++ +FL LDVDE KEIASK EIKAMPTFVLL G Sbjct: 35 VVVHFSAFWCITSTLMNPLFEELASTYQDAMFLNLDVDEFKEIASKFEIKAMPTFVLLNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHSTP 261 G VDKIVGANPDEI+ RVD FIHS P Sbjct: 95 GTAVDKIVGANPDEIKTRVDHFIHSAP 121 >KRH33304.1 hypothetical protein GLYMA_10G114400 [Glycine max] Length = 126 Score = 139 bits (349), Expect = 4e-39 Identities = 63/84 (75%), Positives = 76/84 (90%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 V++HFSA+WC+PS+VMN FFQQLASTY NVLFL +DVDEVKE+ASKL+IKA+PTF L+ G Sbjct: 35 VMIHFSAYWCMPSIVMNHFFQQLASTYHNVLFLNVDVDEVKEVASKLKIKAIPTFCLMNG 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIH 252 G P+DKIVGANPDE+RKR+ FIH Sbjct: 95 GAPMDKIVGANPDELRKRISCFIH 118 >XP_012091425.1 PREDICTED: thioredoxin-like protein CXXS1 [Jatropha curcas] KDP20821.1 hypothetical protein JCGZ_21292 [Jatropha curcas] Length = 125 Score = 138 bits (348), Expect = 5e-39 Identities = 61/85 (71%), Positives = 78/85 (91%) Frame = +1 Query: 1 VVVHFSAFWCVPSMVMNPFFQQLASTYRNVLFLTLDVDEVKEIASKLEIKAMPTFVLLKG 180 +VVHF+A WC+PS+ MNPFF++LASTY +VLFLT+DVD+VKE+ASKLE+KAMPTFVL+K Sbjct: 35 IVVHFTASWCIPSVAMNPFFEELASTYPDVLFLTVDVDDVKEVASKLEVKAMPTFVLMKE 94 Query: 181 GDPVDKIVGANPDEIRKRVDDFIHS 255 G VD++VGANP+EIRKR+D F+HS Sbjct: 95 GAQVDRLVGANPEEIRKRIDGFVHS 119