BLASTX nr result
ID: Glycyrrhiza30_contig00023436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00023436 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004490593.1 PREDICTED: protein DAMAGED DNA-BINDING 2 [Cicer a... 53 4e-06 XP_003615633.2 damaged DNA-binding protein [Medicago truncatula]... 53 4e-06 KZV18313.1 protein DAMAGED DNA-BINDING 2 [Dorcoceras hygrometricum] 53 4e-06 GAV89905.1 WD40 domain-containing protein, partial [Cephalotus f... 52 8e-06 >XP_004490593.1 PREDICTED: protein DAMAGED DNA-BINDING 2 [Cicer arietinum] Length = 555 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +1 Query: 1 KGATYIDCPMKPCFLCKTPGQW*LLYLPHTV 93 KGATYIDCPMKPCFLCKTPG L PH V Sbjct: 87 KGATYIDCPMKPCFLCKTPGHT-TLNCPHRV 116 >XP_003615633.2 damaged DNA-binding protein [Medicago truncatula] AES98591.2 damaged DNA-binding protein [Medicago truncatula] Length = 558 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +1 Query: 1 KGATYIDCPMKPCFLCKTPGQW*LLYLPHTV 93 KGATYIDCPMKPCFLCKTPG L PH V Sbjct: 90 KGATYIDCPMKPCFLCKTPGHT-TLNCPHRV 119 >KZV18313.1 protein DAMAGED DNA-BINDING 2 [Dorcoceras hygrometricum] Length = 595 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +1 Query: 1 KGATYIDCPMKPCFLCKTPGQW*LLYLPHTV 93 KGATYIDCPMKPCFLCKTPG L PH V Sbjct: 84 KGATYIDCPMKPCFLCKTPGHT-TLTCPHRV 113 >GAV89905.1 WD40 domain-containing protein, partial [Cephalotus follicularis] Length = 606 Score = 52.0 bits (123), Expect = 8e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +1 Query: 1 KGATYIDCPMKPCFLCKTPGQW*LLYLPHTV 93 KGATYIDCPMKPCFLCKTPG + PH V Sbjct: 154 KGATYIDCPMKPCFLCKTPGHT-TMACPHRV 183