BLASTX nr result
ID: Glycyrrhiza30_contig00023383
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00023383 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_173442.1 hypothetical protein NitaMp104 [Nicotiana tabacum] B... 80 3e-17 EYU34039.1 hypothetical protein MIMGU_mgv11b016421mg [Erythranth... 75 1e-15 >YP_173442.1 hypothetical protein NitaMp104 [Nicotiana tabacum] BAD83507.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 118 Score = 80.5 bits (197), Expect = 3e-17 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = +1 Query: 238 MGTAPPAARVFDPKGMENETRICVHYLWSGVTILNLLFPIS 360 MGTAP AARV DPKGMENE RICVHYLWSGVTILNLLFPIS Sbjct: 1 MGTAPLAARVSDPKGMENERRICVHYLWSGVTILNLLFPIS 41 >EYU34039.1 hypothetical protein MIMGU_mgv11b016421mg [Erythranthe guttata] Length = 69 Score = 75.1 bits (183), Expect = 1e-15 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 238 MGTAPPAARVFDPKGMENETRICVHYLWSGVTILNLLFPIS 360 MGTAPPAARV DPKG+ENE ICVHYLWSGVTI +L+FPIS Sbjct: 1 MGTAPPAARVSDPKGIENERGICVHYLWSGVTIQHLIFPIS 41