BLASTX nr result
ID: Glycyrrhiza30_contig00022938
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00022938 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004500600.1 PREDICTED: inducible nitrate reductase [NADH] 2 [... 50 7e-06 >XP_004500600.1 PREDICTED: inducible nitrate reductase [NADH] 2 [Cicer arietinum] Length = 868 Score = 49.7 bits (117), Expect(2) = 7e-06 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -2 Query: 280 DWTVTVCGLIKHPTQFTMDQLVHKLQQPQVP 188 DWTV V GL+KHPTQFTMDQL+H + P Sbjct: 127 DWTVEVTGLVKHPTQFTMDQLIHDFPSREFP 157 Score = 27.3 bits (59), Expect(2) = 7e-06 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 186 MVKQSIDFNNYGPSAISTSV 127 MVKQ+I FN +GPSA STS+ Sbjct: 172 MVKQTIGFN-WGPSATSTSL 190