BLASTX nr result
ID: Glycyrrhiza30_contig00022916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00022916 (265 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010023690.1 PREDICTED: UV radiation resistance-associated gen... 54 2e-06 KJB28124.1 hypothetical protein B456_005G031400 [Gossypium raimo... 52 6e-06 XP_006420995.1 hypothetical protein CICLE_v10005271mg [Citrus cl... 52 6e-06 XP_008780679.1 PREDICTED: UV radiation resistance-associated gen... 51 7e-06 XP_012481717.1 PREDICTED: UV radiation resistance-associated gen... 52 9e-06 >XP_010023690.1 PREDICTED: UV radiation resistance-associated gene protein isoform X3 [Eucalyptus grandis] KCW60043.1 hypothetical protein EUGRSUZ_H02773 [Eucalyptus grandis] Length = 350 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 2 FPLFLEGQDTTRAAYAVFLLNKVEWLLLCYL 94 FPLFLEGQDTTRAAYAVFLLNK++ L C L Sbjct: 304 FPLFLEGQDTTRAAYAVFLLNKLQSFLACIL 334 >KJB28124.1 hypothetical protein B456_005G031400 [Gossypium raimondii] Length = 334 Score = 52.4 bits (124), Expect = 6e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 2 FPLFLEGQDTTRAAYAVFLLNKVEWLLLCYL 94 FPLFLEGQDTTRAAYAVFLLNKV + +L L Sbjct: 301 FPLFLEGQDTTRAAYAVFLLNKVSFCILVIL 331 >XP_006420995.1 hypothetical protein CICLE_v10005271mg [Citrus clementina] ESR34235.1 hypothetical protein CICLE_v10005271mg [Citrus clementina] Length = 196 Score = 51.6 bits (122), Expect = 6e-06 Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 5/56 (8%) Frame = +2 Query: 2 FPLFLEGQDTTRAAYAVFLLNKVEWLLLCYLKHAECLCS-----YPLFANFNFFLK 154 FPLFLEGQD TRAAYAVFLLNKV ++ Y+ ++ CS YPL F+++L+ Sbjct: 144 FPLFLEGQDATRAAYAVFLLNKVFFI---YMLSSDQYCSLTQSQYPLM--FSYYLQ 194 >XP_008780679.1 PREDICTED: UV radiation resistance-associated gene protein-like, partial [Phoenix dactylifera] Length = 153 Score = 50.8 bits (120), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 2 FPLFLEGQDTTRAAYAVFLLNKVEWLLLCYL 94 FPLFLEGQD+TRAAYA+FLLNKV LLC++ Sbjct: 117 FPLFLEGQDSTRAAYAIFLLNKVH--LLCFI 145 >XP_012481717.1 PREDICTED: UV radiation resistance-associated gene protein-like isoform X1 [Gossypium raimondii] Length = 377 Score = 52.0 bits (123), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 FPLFLEGQDTTRAAYAVFLLNKVEWLLLCYLKH 100 FPLFLEGQDTTRAAYAVFLLNKV+ + L +H Sbjct: 301 FPLFLEGQDTTRAAYAVFLLNKVKLMFLFGKEH 333