BLASTX nr result
ID: Glycyrrhiza30_contig00022792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00022792 (572 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB80261.1 hypothetical protein B456_013G089300 [Gossypium raimo... 62 5e-08 XP_017603599.1 PREDICTED: CSC1-like protein At1g69450 [Gossypium... 62 5e-08 XP_012463963.1 PREDICTED: CSC1-like protein At1g69450 [Gossypium... 62 5e-08 XP_016705033.1 PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein... 62 5e-08 XP_007045993.1 PREDICTED: CSC1-like protein At1g69450 [Theobroma... 61 2e-07 XP_004490117.1 PREDICTED: CSC1-like protein At1g69450 [Cicer ari... 58 3e-07 KRH70801.1 hypothetical protein GLYMA_02G111500 [Glycine max] 59 6e-07 XP_006574920.1 PREDICTED: CSC1-like protein At1g69450 isoform X3... 59 7e-07 XP_006574918.1 PREDICTED: CSC1-like protein At1g69450 isoform X2... 59 7e-07 XP_006574916.1 PREDICTED: CSC1-like protein At1g69450 isoform X1... 59 7e-07 KCW86556.1 hypothetical protein EUGRSUZ_B03192 [Eucalyptus grandis] 58 2e-06 XP_010044468.1 PREDICTED: CSC1-like protein At1g69450 [Eucalyptu... 58 2e-06 OAY50076.1 hypothetical protein MANES_05G106300 [Manihot esculenta] 57 2e-06 XP_003613914.1 ERD (early-responsive to dehydration stress) fami... 57 2e-06 GAU46556.1 hypothetical protein TSUD_241470 [Trifolium subterran... 53 3e-06 XP_007157718.1 hypothetical protein PHAVU_002G092500g [Phaseolus... 57 3e-06 XP_015894987.1 PREDICTED: CSC1-like protein At1g69450 [Ziziphus ... 57 4e-06 XP_015895046.1 PREDICTED: CSC1-like protein At1g69450 [Ziziphus ... 57 4e-06 KHN24660.1 hypothetical protein glysoja_038384 [Glycine soja] 53 5e-06 XP_018806636.1 PREDICTED: CSC1-like protein At1g69450 [Juglans r... 53 6e-06 >KJB80261.1 hypothetical protein B456_013G089300 [Gossypium raimondii] Length = 645 Score = 62.4 bits (150), Expect = 5e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQMLRH 126 M EFYDNL+ AY DPALLPIQ+S+NSD L SPLIS AQ +RH Sbjct: 605 MAEFYDNLVAAYQDPALLPIQFSANSDSLNSPLISAAQ-VRH 645 >XP_017603599.1 PREDICTED: CSC1-like protein At1g69450 [Gossypium arboreum] XP_017603600.1 PREDICTED: CSC1-like protein At1g69450 [Gossypium arboreum] Length = 715 Score = 62.4 bits (150), Expect = 5e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQMLRH 126 M EFYDNL+ AY DPALLPIQ+S+NSD L SPLIS AQ +RH Sbjct: 675 MAEFYDNLVAAYQDPALLPIQFSANSDSLNSPLISAAQ-VRH 715 >XP_012463963.1 PREDICTED: CSC1-like protein At1g69450 [Gossypium raimondii] XP_012463964.1 PREDICTED: CSC1-like protein At1g69450 [Gossypium raimondii] XP_012463965.1 PREDICTED: CSC1-like protein At1g69450 [Gossypium raimondii] KJB80259.1 hypothetical protein B456_013G089300 [Gossypium raimondii] KJB80262.1 hypothetical protein B456_013G089300 [Gossypium raimondii] KJB80263.1 hypothetical protein B456_013G089300 [Gossypium raimondii] KJB80264.1 hypothetical protein B456_013G089300 [Gossypium raimondii] KJB80265.1 hypothetical protein B456_013G089300 [Gossypium raimondii] KJB80266.1 hypothetical protein B456_013G089300 [Gossypium raimondii] KJB80267.1 hypothetical protein B456_013G089300 [Gossypium raimondii] Length = 715 Score = 62.4 bits (150), Expect = 5e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQMLRH 126 M EFYDNL+ AY DPALLPIQ+S+NSD L SPLIS AQ +RH Sbjct: 675 MAEFYDNLVAAYQDPALLPIQFSANSDSLNSPLISAAQ-VRH 715 >XP_016705033.1 PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g69450 [Gossypium hirsutum] Length = 718 Score = 62.4 bits (150), Expect = 5e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQMLRH 126 M EFYDNL+ AY DPALLPIQ+S+NSD L SPLIS AQ +RH Sbjct: 678 MAEFYDNLVAAYQDPALLPIQFSANSDSLNSPLISAAQ-VRH 718 >XP_007045993.1 PREDICTED: CSC1-like protein At1g69450 [Theobroma cacao] XP_007045994.1 PREDICTED: CSC1-like protein At1g69450 [Theobroma cacao] EOY01825.1 Early-responsive to dehydration stress protein (ERD4) isoform 1 [Theobroma cacao] EOY01826.1 Early-responsive to dehydration stress protein (ERD4) isoform 1 [Theobroma cacao] Length = 715 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQMLRH 126 M EFYDNL+TAY DPALLPIQ+S N+D L SPLIS A+ +RH Sbjct: 675 MEEFYDNLVTAYQDPALLPIQFSPNADSLNSPLISAAE-VRH 715 >XP_004490117.1 PREDICTED: CSC1-like protein At1g69450 [Cicer arietinum] Length = 724 Score = 57.8 bits (138), Expect(2) = 3e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS 105 M EFY+NL+ AY DPAL+PIQYSSN+D L SPLIS Sbjct: 677 MNEFYNNLVDAYKDPALIPIQYSSNNDSLSSPLIS 711 Score = 24.3 bits (51), Expect(2) = 3e-07 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 84 SSQSPYILSSNAEAQCHSIL 143 S SP I NAE QC+SI+ Sbjct: 704 SLSSPLISQLNAEEQCNSII 723 >KRH70801.1 hypothetical protein GLYMA_02G111500 [Glycine max] Length = 470 Score = 58.9 bits (141), Expect = 6e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS 105 MT+FY+NL+ AY DPALLPIQ+S N+D LRSPLIS Sbjct: 434 MTQFYENLVNAYKDPALLPIQHSQNNDNLRSPLIS 468 >XP_006574920.1 PREDICTED: CSC1-like protein At1g69450 isoform X3 [Glycine max] Length = 573 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS 105 MT+FY+NL+ AY DPALLPIQ+S N+D LRSPLIS Sbjct: 537 MTQFYENLVNAYKDPALLPIQHSQNNDNLRSPLIS 571 >XP_006574918.1 PREDICTED: CSC1-like protein At1g69450 isoform X2 [Glycine max] KRH70799.1 hypothetical protein GLYMA_02G111500 [Glycine max] KRH70800.1 hypothetical protein GLYMA_02G111500 [Glycine max] Length = 642 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS 105 MT+FY+NL+ AY DPALLPIQ+S N+D LRSPLIS Sbjct: 606 MTQFYENLVNAYKDPALLPIQHSQNNDNLRSPLIS 640 >XP_006574916.1 PREDICTED: CSC1-like protein At1g69450 isoform X1 [Glycine max] XP_006574917.1 PREDICTED: CSC1-like protein At1g69450 isoform X1 [Glycine max] KHN01989.1 Putative membrane protein C2G11.09 [Glycine soja] KRH70796.1 hypothetical protein GLYMA_02G111500 [Glycine max] KRH70797.1 hypothetical protein GLYMA_02G111500 [Glycine max] Length = 712 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS 105 MT+FY+NL+ AY DPALLPIQ+S N+D LRSPLIS Sbjct: 676 MTQFYENLVNAYKDPALLPIQHSQNNDNLRSPLIS 710 >KCW86556.1 hypothetical protein EUGRSUZ_B03192 [Eucalyptus grandis] Length = 629 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQM 117 M+EF D L+TAY DPAL+PIQYS +SDGL SPLIS A++ Sbjct: 591 MSEFLDRLVTAYQDPALMPIQYSVHSDGLNSPLISSAEV 629 >XP_010044468.1 PREDICTED: CSC1-like protein At1g69450 [Eucalyptus grandis] XP_018724619.1 PREDICTED: CSC1-like protein At1g69450 [Eucalyptus grandis] Length = 716 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQM 117 M+EF D L+TAY DPAL+PIQYS +SDGL SPLIS A++ Sbjct: 678 MSEFLDRLVTAYQDPALMPIQYSVHSDGLNSPLISSAEV 716 >OAY50076.1 hypothetical protein MANES_05G106300 [Manihot esculenta] Length = 709 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS 105 M EF+D L+TAY DPAL+PIQYS NSD L SPLIS Sbjct: 672 MAEFFDKLVTAYQDPALMPIQYSVNSDSLNSPLIS 706 >XP_003613914.1 ERD (early-responsive to dehydration stress) family protein [Medicago truncatula] AES96872.1 ERD (early-responsive to dehydration stress) family protein [Medicago truncatula] Length = 711 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS 105 +TEFY NL+ AY DPAL+PIQYSSN+D L SPLIS Sbjct: 675 LTEFYHNLVDAYKDPALVPIQYSSNNDSLSSPLIS 709 >GAU46556.1 hypothetical protein TSUD_241470 [Trifolium subterraneum] Length = 82 Score = 53.1 bits (126), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQY-SSNSDGLRSPLIS 105 MTEFY+NL+ Y DPAL+PIQY SSN+D L SPLIS Sbjct: 45 MTEFYNNLVDVYKDPALVPIQYSSSNTDSLSSPLIS 80 >XP_007157718.1 hypothetical protein PHAVU_002G092500g [Phaseolus vulgaris] ESW29712.1 hypothetical protein PHAVU_002G092500g [Phaseolus vulgaris] Length = 714 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLI 102 MT+FY+NL+ AY DPALLP+QYS N+D LR+PLI Sbjct: 678 MTQFYENLVNAYKDPALLPLQYSPNNDNLRTPLI 711 >XP_015894987.1 PREDICTED: CSC1-like protein At1g69450 [Ziziphus jujuba] Length = 565 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQM 117 M+EFY+ L+ AY DPAL+P+++SS+SDGL SPLIS AQ+ Sbjct: 527 MSEFYNKLVIAYQDPALMPVRFSSSSDGLNSPLISSAQV 565 >XP_015895046.1 PREDICTED: CSC1-like protein At1g69450 [Ziziphus jujuba] Length = 719 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS*AQM 117 M+EFY+ L+ AY DPAL+P+++SS+SDGL SPLIS AQ+ Sbjct: 681 MSEFYNKLVIAYQDPALMPVRFSSSSDGLNSPLISSAQV 719 >KHN24660.1 hypothetical protein glysoja_038384 [Glycine soja] Length = 101 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSS-NSDGLRSPLIS 105 MT+FY+NL+ AY DPALLPIQ+S N+D +RSPLIS Sbjct: 64 MTQFYENLVNAYKDPALLPIQHSPYNNDSIRSPLIS 99 >XP_018806636.1 PREDICTED: CSC1-like protein At1g69450 [Juglans regia] Length = 100 Score = 52.8 bits (125), Expect = 6e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +1 Query: 1 MTEFYDNLLTAYNDPALLPIQYSSNSDGLRSPLIS 105 M EF+D L+TAY DPAL+PIQ S+N D L SPL+S Sbjct: 64 MAEFFDKLVTAYQDPALMPIQLSANPDSLNSPLLS 98