BLASTX nr result
ID: Glycyrrhiza30_contig00022500
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00022500 (471 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006445216.1 hypothetical protein CICLE_v100184681mg, partial ... 53 3e-06 XP_011034742.1 PREDICTED: uncharacterized protein LOC105132766 [... 55 5e-06 XP_002320744.2 hypothetical protein POPTR_0014s06850g [Populus t... 55 5e-06 KHN20456.1 BEACH domain-containing protein lvsC [Glycine soja] 55 7e-06 KHN29431.1 BEACH domain-containing protein lvsC [Glycine soja] 55 7e-06 XP_007139978.1 hypothetical protein PHAVU_008G074600g [Phaseolus... 55 7e-06 XP_007139977.1 hypothetical protein PHAVU_008G074600g [Phaseolus... 55 7e-06 KRH00607.1 hypothetical protein GLYMA_18G223300 [Glycine max] 55 7e-06 XP_017418184.1 PREDICTED: BEACH domain-containing protein C2 [Vi... 55 7e-06 BAT83800.1 hypothetical protein VIGAN_04102500 [Vigna angularis ... 55 7e-06 XP_014490269.1 PREDICTED: BEACH domain-containing protein C2 [Vi... 55 7e-06 XP_007139976.1 hypothetical protein PHAVU_008G074600g [Phaseolus... 55 7e-06 XP_019412874.1 PREDICTED: BEACH domain-containing protein C2-lik... 55 7e-06 XP_003533636.1 PREDICTED: BEACH domain-containing protein C2-lik... 55 7e-06 XP_006602760.2 PREDICTED: BEACH domain-containing protein C2-lik... 55 7e-06 XP_019412873.1 PREDICTED: BEACH domain-containing protein C2-lik... 55 7e-06 XP_019412872.1 PREDICTED: BEACH domain-containing protein C2-lik... 55 7e-06 OIV98736.1 hypothetical protein TanjilG_24907 [Lupinus angustifo... 55 7e-06 >XP_006445216.1 hypothetical protein CICLE_v100184681mg, partial [Citrus clementina] ESR58456.1 hypothetical protein CICLE_v100184681mg, partial [Citrus clementina] Length = 108 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGL PLIKS Sbjct: 83 ALSLKVVDQMLKLGWEGDGLSPLIKS 108 >XP_011034742.1 PREDICTED: uncharacterized protein LOC105132766 [Populus euphratica] Length = 2995 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS*LLGY 377 ALSLKVVDQMLKLGWEGDGL PLIKS LG+ Sbjct: 2965 ALSLKVVDQMLKLGWEGDGLSPLIKSQRLGH 2995 >XP_002320744.2 hypothetical protein POPTR_0014s06850g [Populus trichocarpa] EEE99059.2 hypothetical protein POPTR_0014s06850g [Populus trichocarpa] Length = 3057 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS*LLGY 377 ALSLKVVDQMLKLGWEGDGL PLIKS LG+ Sbjct: 3027 ALSLKVVDQMLKLGWEGDGLSPLIKSQRLGH 3057 >KHN20456.1 BEACH domain-containing protein lvsC [Glycine soja] Length = 830 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 805 ALSLKVVDQMLKLGWEGDGLQPLIKS 830 >KHN29431.1 BEACH domain-containing protein lvsC [Glycine soja] Length = 1683 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 1658 ALSLKVVDQMLKLGWEGDGLQPLIKS 1683 >XP_007139978.1 hypothetical protein PHAVU_008G074600g [Phaseolus vulgaris] ESW11972.1 hypothetical protein PHAVU_008G074600g [Phaseolus vulgaris] Length = 1799 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 1774 ALSLKVVDQMLKLGWEGDGLQPLIKS 1799 >XP_007139977.1 hypothetical protein PHAVU_008G074600g [Phaseolus vulgaris] ESW11971.1 hypothetical protein PHAVU_008G074600g [Phaseolus vulgaris] Length = 2262 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2237 ALSLKVVDQMLKLGWEGDGLQPLIKS 2262 >KRH00607.1 hypothetical protein GLYMA_18G223300 [Glycine max] Length = 2906 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2881 ALSLKVVDQMLKLGWEGDGLQPLIKS 2906 >XP_017418184.1 PREDICTED: BEACH domain-containing protein C2 [Vigna angularis] Length = 2948 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2923 ALSLKVVDQMLKLGWEGDGLQPLIKS 2948 >BAT83800.1 hypothetical protein VIGAN_04102500 [Vigna angularis var. angularis] Length = 2948 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2923 ALSLKVVDQMLKLGWEGDGLQPLIKS 2948 >XP_014490269.1 PREDICTED: BEACH domain-containing protein C2 [Vigna radiata var. radiata] Length = 2948 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2923 ALSLKVVDQMLKLGWEGDGLQPLIKS 2948 >XP_007139976.1 hypothetical protein PHAVU_008G074600g [Phaseolus vulgaris] ESW11970.1 hypothetical protein PHAVU_008G074600g [Phaseolus vulgaris] Length = 2954 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2929 ALSLKVVDQMLKLGWEGDGLQPLIKS 2954 >XP_019412874.1 PREDICTED: BEACH domain-containing protein C2-like isoform X3 [Lupinus angustifolius] XP_019412876.1 PREDICTED: BEACH domain-containing protein C2-like isoform X3 [Lupinus angustifolius] Length = 2958 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2933 ALSLKVVDQMLKLGWEGDGLQPLIKS 2958 >XP_003533636.1 PREDICTED: BEACH domain-containing protein C2-like [Glycine max] KRH40567.1 hypothetical protein GLYMA_09G267100 [Glycine max] Length = 2961 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2936 ALSLKVVDQMLKLGWEGDGLQPLIKS 2961 >XP_006602760.2 PREDICTED: BEACH domain-containing protein C2-like isoform X1 [Glycine max] KRH00608.1 hypothetical protein GLYMA_18G223300 [Glycine max] Length = 2964 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2939 ALSLKVVDQMLKLGWEGDGLQPLIKS 2964 >XP_019412873.1 PREDICTED: BEACH domain-containing protein C2-like isoform X2 [Lupinus angustifolius] Length = 3022 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 2997 ALSLKVVDQMLKLGWEGDGLQPLIKS 3022 >XP_019412872.1 PREDICTED: BEACH domain-containing protein C2-like isoform X1 [Lupinus angustifolius] Length = 3025 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 3000 ALSLKVVDQMLKLGWEGDGLQPLIKS 3025 >OIV98736.1 hypothetical protein TanjilG_24907 [Lupinus angustifolius] Length = 3107 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 469 ALSLKVVDQMLKLGWEGDGLQPLIKS 392 ALSLKVVDQMLKLGWEGDGLQPLIKS Sbjct: 3082 ALSLKVVDQMLKLGWEGDGLQPLIKS 3107