BLASTX nr result
ID: Glycyrrhiza30_contig00022021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00022021 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002306594.1 hypothetical protein POPTR_0005s16475g [Populus t... 74 4e-15 ONK69943.1 uncharacterized protein A4U43_C05F28580, partial [Asp... 78 5e-15 ONK66397.1 uncharacterized protein A4U43_C06F7420 [Asparagus off... 76 4e-14 XP_019170210.1 PREDICTED: guanylate-binding protein 4 [Ipomoea nil] 76 4e-14 XP_010686393.1 PREDICTED: guanylate-binding protein 3 [Beta vulg... 76 4e-14 KNA17107.1 hypothetical protein SOVF_083190 [Spinacia oleracea] 76 4e-14 XP_018811300.1 PREDICTED: guanylate-binding protein 1-like [Jugl... 76 6e-14 XP_002453752.1 hypothetical protein SORBIDRAFT_04g013170 [Sorghu... 73 6e-14 XP_014511298.1 PREDICTED: guanylate-binding protein 2-like [Vign... 71 7e-14 KDO77716.1 hypothetical protein CISIN_1g001482mg [Citrus sinensis] 75 8e-14 KDO77715.1 hypothetical protein CISIN_1g001482mg [Citrus sinensis] 75 8e-14 XP_006449417.1 hypothetical protein CICLE_v10014139mg [Citrus cl... 75 8e-14 XP_016190041.1 PREDICTED: guanylate-binding protein 1 [Arachis i... 75 8e-14 XP_015956415.1 PREDICTED: guanylate-binding protein 1 [Arachis d... 75 8e-14 KGN49263.1 hypothetical protein Csa_6G518180 [Cucumis sativus] 75 8e-14 KYP76312.1 Interferon-induced guanylate-binding protein 2 [Cajan... 75 8e-14 XP_004134683.2 PREDICTED: interferon-induced guanylate-binding p... 75 8e-14 XP_008439803.1 PREDICTED: guanylate-binding protein 2 [Cucumis m... 75 8e-14 XP_015875127.1 PREDICTED: guanylate-binding protein 3 isoform X1... 75 8e-14 GAV87507.1 GBP domain-containing protein/GBP_C domain-containing... 75 8e-14 >XP_002306594.1 hypothetical protein POPTR_0005s16475g [Populus trichocarpa] EEE93590.1 hypothetical protein POPTR_0005s16475g [Populus trichocarpa] Length = 112 Score = 74.3 bits (181), Expect = 4e-15 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGT+YNLL Sbjct: 11 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTQYNLL 51 >ONK69943.1 uncharacterized protein A4U43_C05F28580, partial [Asparagus officinalis] Length = 337 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = +3 Query: 51 LRMLESSEAIG*LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LRML+S LLGRSSGFQV+STH PCTKGLW WS +KRT+ DGTEYNL+ Sbjct: 62 LRMLKSICGFWQLLGRSSGFQVASTHRPCTKGLWMWSAPIKRTSLDGTEYNLV 114 >ONK66397.1 uncharacterized protein A4U43_C06F7420 [Asparagus officinalis] Length = 1029 Score = 76.3 bits (186), Expect = 4e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WSV +KRT DGTEYNLL Sbjct: 54 LLGRSSGFQVASTHRPCTKGLWMWSVPIKRTALDGTEYNLL 94 >XP_019170210.1 PREDICTED: guanylate-binding protein 4 [Ipomoea nil] Length = 1067 Score = 76.3 bits (186), Expect = 4e-14 Identities = 39/66 (59%), Positives = 43/66 (65%) Frame = +3 Query: 18 GRRKRAKDYKRLRMLESSEAIG*LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTE 197 GR ++ K Y + LLGRSSGFQV+STH PCTKGLW WS LKRT DGTE Sbjct: 77 GRARQGKSY----------ILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTE 126 Query: 198 YNLLPI 215 YNLL I Sbjct: 127 YNLLLI 132 >XP_010686393.1 PREDICTED: guanylate-binding protein 3 [Beta vulgaris subsp. vulgaris] KMT04588.1 hypothetical protein BVRB_8g182440 [Beta vulgaris subsp. vulgaris] Length = 1078 Score = 76.3 bits (186), Expect = 4e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WSV LKRT DGTEYNL+ Sbjct: 99 LLGRSSGFQVASTHKPCTKGLWLWSVPLKRTALDGTEYNLI 139 >KNA17107.1 hypothetical protein SOVF_083190 [Spinacia oleracea] Length = 1080 Score = 76.3 bits (186), Expect = 4e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WSV LKRT DGTEYNL+ Sbjct: 103 LLGRSSGFQVASTHKPCTKGLWLWSVPLKRTALDGTEYNLI 143 >XP_018811300.1 PREDICTED: guanylate-binding protein 1-like [Juglans regia] Length = 1065 Score = 75.9 bits (185), Expect = 6e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT+ DGTEYNLL Sbjct: 86 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTSLDGTEYNLL 126 >XP_002453752.1 hypothetical protein SORBIDRAFT_04g013170 [Sorghum bicolor] Length = 177 Score = 72.8 bits (177), Expect = 6e-14 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS +KRT DGTEY+LL Sbjct: 101 LLGRSSGFQVASTHRPCTKGLWMWSAPIKRTALDGTEYSLL 141 >XP_014511298.1 PREDICTED: guanylate-binding protein 2-like [Vigna radiata var. radiata] Length = 104 Score = 70.9 bits (172), Expect = 7e-14 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLG+SSGFQV+STH PCTKGLW WS LKRT DGT+YN L Sbjct: 36 LLGKSSGFQVASTHRPCTKGLWLWSTPLKRTALDGTDYNRL 76 >KDO77716.1 hypothetical protein CISIN_1g001482mg [Citrus sinensis] Length = 716 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 91 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 131 >KDO77715.1 hypothetical protein CISIN_1g001482mg [Citrus sinensis] Length = 736 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 91 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 131 >XP_006449417.1 hypothetical protein CICLE_v10014139mg [Citrus clementina] ESR62657.1 hypothetical protein CICLE_v10014139mg [Citrus clementina] Length = 1002 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 91 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 131 >XP_016190041.1 PREDICTED: guanylate-binding protein 1 [Arachis ipaensis] Length = 1009 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 36 LLGRSSGFQVASTHKPCTKGLWLWSTPLKRTALDGTEYNLL 76 >XP_015956415.1 PREDICTED: guanylate-binding protein 1 [Arachis duranensis] Length = 1009 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 36 LLGRSSGFQVASTHKPCTKGLWLWSTPLKRTALDGTEYNLL 76 >KGN49263.1 hypothetical protein Csa_6G518180 [Cucumis sativus] Length = 1009 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 84 LLGRSSGFQVASTHRPCTKGLWLWSTPLKRTALDGTEYNLL 124 >KYP76312.1 Interferon-induced guanylate-binding protein 2 [Cajanus cajan] Length = 1033 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 88 LLGRSSGFQVASTHRPCTKGLWLWSTPLKRTALDGTEYNLL 128 >XP_004134683.2 PREDICTED: interferon-induced guanylate-binding protein 2 [Cucumis sativus] Length = 1062 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 84 LLGRSSGFQVASTHRPCTKGLWLWSTPLKRTALDGTEYNLL 124 >XP_008439803.1 PREDICTED: guanylate-binding protein 2 [Cucumis melo] Length = 1063 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 84 LLGRSSGFQVASTHRPCTKGLWLWSTPLKRTALDGTEYNLL 124 >XP_015875127.1 PREDICTED: guanylate-binding protein 3 isoform X1 [Ziziphus jujuba] Length = 1065 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 87 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 127 >GAV87507.1 GBP domain-containing protein/GBP_C domain-containing protein [Cephalotus follicularis] Length = 1066 Score = 75.5 bits (184), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 87 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 209 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 87 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 127