BLASTX nr result
ID: Glycyrrhiza30_contig00021889
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00021889 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_037564919.1 hypothetical protein [Staphylococcus agnetis] 87 3e-21 CEG21162.1 hypothetical protein BN1080_00055 [Planococcus massil... 65 1e-11 >WP_037564919.1 hypothetical protein [Staphylococcus agnetis] Length = 59 Score = 87.4 bits (215), Expect = 3e-21 Identities = 43/53 (81%), Positives = 43/53 (81%) Frame = -3 Query: 161 MLLPSGPDMVHGFILHRTEIFKHYVLRADFTKIRPQQRN*VSHKADFEYREPL 3 MLLPSGPDMVHGFILH TEIFKH VL ADFT PQQRN SHKA FE REPL Sbjct: 1 MLLPSGPDMVHGFILHGTEIFKHLVLWADFTNTHPQQRNSASHKAVFENREPL 53 >CEG21162.1 hypothetical protein BN1080_00055 [Planococcus massiliensis] Length = 135 Score = 65.5 bits (158), Expect = 1e-11 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -3 Query: 239 SNAYHKRYRSR*LNLGYPTAHMRIHLMLLPSGPDMVHGFILHRTE 105 S A HKRY R L+LG P AH + HLMLLPSGPDMVHGF L RT+ Sbjct: 35 STAAHKRYPCRWLDLGNPAAHEKFHLMLLPSGPDMVHGFPLRRTQ 79