BLASTX nr result
ID: Glycyrrhiza30_contig00021868
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00021868 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019464673.1 PREDICTED: chaperone protein dnaJ 20, chloroplast... 54 2e-06 >XP_019464673.1 PREDICTED: chaperone protein dnaJ 20, chloroplastic-like [Lupinus angustifolius] OIW00578.1 hypothetical protein TanjilG_14804 [Lupinus angustifolius] Length = 193 Score = 53.5 bits (127), Expect = 2e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = +2 Query: 176 PTRNFAGSLKAKASLNDEFVASK--SQLSFYKLLGIPESGSLME 301 PTR GSL+ KAS+N VAS+ SQLSFY+LLGIP SGSLME Sbjct: 35 PTRTTFGSLRTKASINGGHVASEEASQLSFYELLGIPLSGSLME 78