BLASTX nr result
ID: Glycyrrhiza30_contig00020807
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00020807 (441 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU20086.1 hypothetical protein TSUD_381780 [Trifolium subterran... 65 2e-09 XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 63 9e-09 XP_003602616.1 F-box protein interaction domain protein [Medicag... 62 2e-08 XP_013458778.1 F-box protein interaction domain protein [Medicag... 62 2e-08 XP_004486105.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 62 2e-08 XP_019420066.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 61 3e-08 XP_003594087.1 F-box protein interaction domain protein [Medicag... 61 3e-08 GAU16388.1 hypothetical protein TSUD_117370 [Trifolium subterran... 60 8e-08 XP_003598334.1 F-box protein interaction domain protein [Medicag... 60 8e-08 GAU24892.1 hypothetical protein TSUD_116160 [Trifolium subterran... 59 2e-07 XP_013462705.1 glutamine synthetase [Medicago truncatula] KEH367... 59 3e-07 XP_013464668.1 F-box protein interaction domain protein [Medicag... 58 4e-07 XP_013443080.1 F-box protein interaction domain protein [Medicag... 58 5e-07 GAU16387.1 hypothetical protein TSUD_117360 [Trifolium subterran... 57 1e-06 KYP72801.1 hypothetical protein KK1_005403 [Cajanus cajan] 53 1e-06 XP_003594508.2 F-box protein interaction domain protein [Medicag... 57 1e-06 XP_003592682.2 F-box protein interaction domain protein [Medicag... 56 2e-06 AFK46973.1 unknown [Lotus japonicus] 52 3e-06 AFK49560.1 unknown [Medicago truncatula] 52 4e-06 XP_003602613.1 F-box protein interaction domain protein [Medicag... 55 6e-06 >GAU20086.1 hypothetical protein TSUD_381780 [Trifolium subterraneum] Length = 406 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = -2 Query: 440 YISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 Y+SEDDQ+LL QS L+V+NS+ GT++ E QN NG VP+VY ESL+SPCS Sbjct: 355 YVSEDDQVLLKC-QSELVVYNSRDGTFRTPEFQNNNGWKVPQVYQESLISPCS 406 >XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 405 Score = 62.8 bits (151), Expect = 9e-09 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -2 Query: 440 YISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPC 285 +ISEDDQ+LL S+L+V+NS+ GT+K ++QN N MVPE+Y ESL+SPC Sbjct: 352 HISEDDQVLLEFD-SKLVVYNSRDGTFKTPQIQNINDWMVPEIYQESLISPC 402 >XP_003602616.1 F-box protein interaction domain protein [Medicago truncatula] AES72867.1 F-box protein interaction domain protein [Medicago truncatula] Length = 345 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 5/58 (8%) Frame = -2 Query: 440 YISEDDQLLLVV-----SQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 YISEDDQ L+ + S+ +L V++SKIGT K +QN NG M PE+Y ESL+SPCS Sbjct: 288 YISEDDQFLIDLYERTSSKMKLGVYDSKIGTLKFHMIQNINGWMGPEIYAESLISPCS 345 >XP_013458778.1 F-box protein interaction domain protein [Medicago truncatula] KEH32810.1 F-box protein interaction domain protein [Medicago truncatula] Length = 381 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 6/61 (9%) Frame = -2 Query: 440 YISEDDQLLLVV------SQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS* 279 Y++EDDQLL+ V S+ +L+V+NSK GT K ++QN + M PEVY+ESL+SPCS Sbjct: 321 YVTEDDQLLMKVHELVSSSKVKLVVYNSKSGTLKFPKIQNIDYLMDPEVYIESLISPCSK 380 Query: 278 Y 276 Y Sbjct: 381 Y 381 >XP_004486105.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 384 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -2 Query: 440 YISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPC 285 Y+SEDDQ+LL S+L+ +NS GT+K +QN G MVPE+Y ESL+SPC Sbjct: 331 YVSEDDQVLLECD-SKLVTYNSSHGTFKTPRIQNIKGWMVPEIYQESLISPC 381 >XP_019420066.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Lupinus angustifolius] OIV95875.1 hypothetical protein TanjilG_06851 [Lupinus angustifolius] Length = 367 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/52 (53%), Positives = 43/52 (82%) Frame = -2 Query: 437 ISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 ISE+D++LL QS L+V+NS+ GT+++ E+Q+ +G +PE+YVESL+SPCS Sbjct: 317 ISENDEVLLEF-QSTLVVYNSRNGTFRVPEIQDISGWAIPEIYVESLISPCS 367 >XP_003594087.1 F-box protein interaction domain protein [Medicago truncatula] AES64338.1 F-box protein interaction domain protein [Medicago truncatula] Length = 375 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/53 (54%), Positives = 42/53 (79%) Frame = -2 Query: 440 YISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 Y++EDDQ+LL Q+ L+V+NS+ GT+K E+Q+ N +VP+VY ESL+SPCS Sbjct: 324 YLTEDDQVLLKY-QAELVVYNSRDGTFKTPEIQHINRWLVPQVYQESLISPCS 375 >GAU16388.1 hypothetical protein TSUD_117370 [Trifolium subterraneum] Length = 410 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 5/57 (8%) Frame = -2 Query: 440 YISEDDQLLLVV-----SQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPC 285 YISEDDQLL+ ++ +L+V++SK GT KI +QN NG P+VYVESL+SPC Sbjct: 353 YISEDDQLLIYFHKWRSNELKLVVYDSKNGTSKIPSIQNINGLSSPQVYVESLISPC 409 >XP_003598334.1 F-box protein interaction domain protein [Medicago truncatula] AES68585.1 F-box protein interaction domain protein [Medicago truncatula] Length = 417 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/58 (51%), Positives = 43/58 (74%), Gaps = 5/58 (8%) Frame = -2 Query: 440 YISEDDQLLLVV-----SQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 Y++EDDQLL+ V S+ +L+V+NSK GT K ++QN + M PEVY+ES++SPCS Sbjct: 338 YVNEDDQLLMKVYDLGSSKVKLVVYNSKSGTLKFPKIQNIDYLMDPEVYIESVISPCS 395 >GAU24892.1 hypothetical protein TSUD_116160 [Trifolium subterraneum] Length = 435 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 5/58 (8%) Frame = -2 Query: 440 YISEDDQLLLVVSQS-----RLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 YIS +DQLL+ +S +L+V++SK GT+ I ++QN NG M+ +VY+ESL+SPCS Sbjct: 378 YISGNDQLLMGFYESGSSKLKLVVYDSKNGTFMIPKIQNLNGCMITQVYIESLISPCS 435 >XP_013462705.1 glutamine synthetase [Medicago truncatula] KEH36740.1 glutamine synthetase [Medicago truncatula] Length = 387 Score = 58.5 bits (140), Expect = 3e-07 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = -2 Query: 440 YISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 Y+ EDDQ+LL QS+L+++NS+ GT+K E+Q+ +G MVP+VY +SL+S CS Sbjct: 336 YVYEDDQVLLEC-QSKLVLYNSRDGTFKSLEIQSTDGWMVPQVYQQSLISLCS 387 >XP_013464668.1 F-box protein interaction domain protein [Medicago truncatula] KEH38703.1 F-box protein interaction domain protein [Medicago truncatula] Length = 310 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 5/58 (8%) Frame = -2 Query: 440 YISEDDQLL-----LVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 YISED+ LL L QS+L+V++SK GT +I +QN G + PEVY+ESL+SPCS Sbjct: 253 YISEDEILLMDFGKLECYQSKLVVYDSKDGTLEIPTIQNIGGWIHPEVYIESLISPCS 310 >XP_013443080.1 F-box protein interaction domain protein [Medicago truncatula] KEH17105.1 F-box protein interaction domain protein [Medicago truncatula] Length = 392 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 5/58 (8%) Frame = -2 Query: 440 YISEDDQLLLVV-----SQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 Y+SEDD++L+ S+ +L+V++SK GT KI +QN N M P+VY+ESL+SPCS Sbjct: 335 YVSEDDKMLMEFYELGSSKLKLVVYDSKNGTLKIPVIQNINRRMDPKVYIESLISPCS 392 >GAU16387.1 hypothetical protein TSUD_117360 [Trifolium subterraneum] Length = 354 Score = 56.6 bits (135), Expect = 1e-06 Identities = 30/57 (52%), Positives = 41/57 (71%), Gaps = 5/57 (8%) Frame = -2 Query: 440 YISEDDQLL-----LVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPC 285 YIS+DDQLL L ++ L+V++SK GT+KI ++QN N M P+VY ESL+SPC Sbjct: 297 YISDDDQLLINFYELGSNELDLVVYDSKNGTWKIPDIQNINRLMDPQVYAESLISPC 353 >KYP72801.1 hypothetical protein KK1_005403 [Cajanus cajan] Length = 83 Score = 53.1 bits (126), Expect = 1e-06 Identities = 25/52 (48%), Positives = 39/52 (75%) Frame = -2 Query: 437 ISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 +SEDDQLLL S+++V+N++ TY+ ++Q+ N + EVY+ESL+SPCS Sbjct: 33 LSEDDQLLLEFG-SKIVVYNTRDSTYETLQIQDINECVASEVYIESLISPCS 83 >XP_003594508.2 F-box protein interaction domain protein [Medicago truncatula] AES64759.2 F-box protein interaction domain protein [Medicago truncatula] Length = 405 Score = 56.6 bits (135), Expect = 1e-06 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -2 Query: 440 YISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 Y++EDDQ+LL +Q L+V+NS+ GT K E N G MV EVY ESL+SPCS Sbjct: 354 YVTEDDQVLLE-NQFELVVYNSRDGTSKTLEFPNIKGWMVLEVYQESLISPCS 405 >XP_003592682.2 F-box protein interaction domain protein [Medicago truncatula] AES62933.2 F-box protein interaction domain protein [Medicago truncatula] Length = 247 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = -2 Query: 440 YISEDDQLL---LVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSP 288 YISEDDQ+L L + + L+V++SK T KI E+QN NG M P Y+ESL+SP Sbjct: 193 YISEDDQVLMQFLKMGKFSLLVYDSKNDTLKIPEIQNVNGRMTPNTYIESLISP 246 >AFK46973.1 unknown [Lotus japonicus] Length = 83 Score = 52.4 bits (124), Expect = 3e-06 Identities = 24/53 (45%), Positives = 38/53 (71%) Frame = -2 Query: 440 YISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 +ISED ++LL+ + +L+++NS+ T+K +Q+ N M VYVESL+SPCS Sbjct: 30 HISEDGEVLLLDHRGKLVLYNSREATFKTARIQDSNRPMDSAVYVESLISPCS 82 >AFK49560.1 unknown [Medicago truncatula] Length = 84 Score = 52.0 bits (123), Expect = 4e-06 Identities = 25/53 (47%), Positives = 37/53 (69%) Frame = -2 Query: 440 YISEDDQLLLVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 Y+ EDDQ+LL +L+V+NS+ GT+K ++Q M+PEV ESL+SPC+ Sbjct: 32 YVYEDDQVLLEYMM-KLVVYNSRDGTFKTLKIQRRRDWMIPEVCQESLISPCA 83 >XP_003602613.1 F-box protein interaction domain protein [Medicago truncatula] AES72864.1 F-box protein interaction domain protein [Medicago truncatula] Length = 348 Score = 54.7 bits (130), Expect = 6e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 413 LVVSQSRLIVHNSKIGTYKIREVQNWNGGMVPEVYVESLVSPCS 282 L S+ L V++SK GT KI E+QN NG + PEVYVESL+SPCS Sbjct: 305 LTSSELTLAVYDSKNGTLKIPEIQNTNGWIDPEVYVESLISPCS 348