BLASTX nr result
ID: Glycyrrhiza30_contig00020796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00020796 (794 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014624975.1 PREDICTED: LOW QUALITY PROTEIN: probable F-box pr... 57 7e-06 KHN03492.1 Putative F-box protein [Glycine soja] KRH02039.1 hypo... 57 7e-06 XP_014624971.1 PREDICTED: probable F-box protein At4g22030 [Glyc... 57 1e-05 >XP_014624975.1 PREDICTED: LOW QUALITY PROTEIN: probable F-box protein At4g22030 [Glycine max] Length = 410 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 154 SLRRVNASLHLPNPSRVPYSDPKVPTEKLQIEDFNGS 264 SLR+ NAS+HLP PSRV YS PKVPT KL +E+FN S Sbjct: 13 SLRKFNASIHLPKPSRVTYSVPKVPTRKLLVEEFNAS 49 >KHN03492.1 Putative F-box protein [Glycine soja] KRH02039.1 hypothetical protein GLYMA_17G011800 [Glycine max] Length = 419 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 154 SLRRVNASLHLPNPSRVPYSDPKVPTEKLQIEDFNGS 264 SLR+ NAS+HLP PSRV YS PKVPT KL +E+FN S Sbjct: 13 SLRKFNASIHLPKPSRVTYSVPKVPTRKLLVEEFNAS 49 >XP_014624971.1 PREDICTED: probable F-box protein At4g22030 [Glycine max] KHN03493.1 Putative F-box protein [Glycine soja] KRH02038.1 hypothetical protein GLYMA_17G011700 [Glycine max] Length = 423 Score = 57.0 bits (136), Expect = 1e-05 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 163 RVNASLHLPNPSRVPYSDPKVPTEKLQIEDFNGS 264 +VNAS+H+PNP RV Y PKVPT KLQIE+FNGS Sbjct: 20 KVNASIHVPNPPRVTYPVPKVPTRKLQIEEFNGS 53