BLASTX nr result
ID: Glycyrrhiza30_contig00020664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00020664 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU36027.1 hypothetical protein TSUD_207960 [Trifolium subterran... 168 5e-47 GAU36028.1 hypothetical protein TSUD_207970 [Trifolium subterran... 168 1e-46 XP_016193453.1 PREDICTED: DNAJ protein JJJ1 homolog [Arachis ipa... 166 5e-46 KRH03127.1 hypothetical protein GLYMA_17G078100 [Glycine max] 164 1e-45 XP_014630906.1 PREDICTED: dnaJ homolog subfamily C member 21-lik... 164 2e-45 XP_003524632.1 PREDICTED: dnaJ homolog subfamily C member 21-lik... 164 3e-45 XP_006600575.1 PREDICTED: dnaJ homolog subfamily C member 21-lik... 164 3e-45 XP_019460506.1 PREDICTED: DNAJ protein JJJ1 homolog [Lupinus ang... 164 6e-45 XP_012080375.1 PREDICTED: dnaJ homolog subfamily C member 21 [Ja... 163 1e-44 XP_007155239.1 hypothetical protein PHAVU_003G185100g [Phaseolus... 162 2e-44 EEF47765.1 conserved hypothetical protein [Ricinus communis] 160 3e-44 XP_007210718.1 hypothetical protein PRUPE_ppa022955mg [Prunus pe... 160 4e-44 XP_015943390.1 PREDICTED: DNAJ protein JJJ1 homolog [Arachis dur... 161 5e-44 XP_004508679.1 PREDICTED: dnaJ homolog subfamily C member 21 [Ci... 161 6e-44 XP_015572095.1 PREDICTED: dnaJ homolog subfamily C member 21 [Ri... 160 6e-44 OIW18519.1 hypothetical protein TanjilG_13271 [Lupinus angustifo... 160 7e-44 XP_014510461.1 PREDICTED: dnaJ homolog subfamily C member 21 iso... 160 7e-44 XP_004138317.1 PREDICTED: dnaJ homolog subfamily C member 21 [Cu... 160 7e-44 XP_014510460.1 PREDICTED: dnaJ homolog subfamily C member 21 iso... 160 1e-43 XP_008240022.1 PREDICTED: DNAJ protein JJJ1 homolog [Prunus mume] 160 1e-43 >GAU36027.1 hypothetical protein TSUD_207960 [Trifolium subterraneum] Length = 544 Score = 168 bits (425), Expect = 5e-47 Identities = 82/88 (93%), Positives = 84/88 (95%) Frame = -3 Query: 264 MASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAY 85 MASAKRCHYEVLGLSRDC PDEIRS YR+LALQRHPDKLV+SGLSQSEATAQFQELQ AY Sbjct: 1 MASAKRCHYEVLGLSRDCLPDEIRSCYRKLALQRHPDKLVKSGLSQSEATAQFQELQHAY 60 Query: 84 EVLSDPKERAWYDSHRSQILFSDPNSLS 1 EVLSDPKERAWYDSHRSQILFSDPNS S Sbjct: 61 EVLSDPKERAWYDSHRSQILFSDPNSHS 88 >GAU36028.1 hypothetical protein TSUD_207970 [Trifolium subterraneum] Length = 599 Score = 168 bits (425), Expect = 1e-46 Identities = 82/88 (93%), Positives = 84/88 (95%) Frame = -3 Query: 264 MASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAY 85 MASAKRCHYEVLGLSRDC PDEIRS YR+LALQRHPDKLV+SGLSQSEATAQFQELQ AY Sbjct: 1 MASAKRCHYEVLGLSRDCLPDEIRSCYRKLALQRHPDKLVKSGLSQSEATAQFQELQHAY 60 Query: 84 EVLSDPKERAWYDSHRSQILFSDPNSLS 1 EVLSDPKERAWYDSHRSQILFSDPNS S Sbjct: 61 EVLSDPKERAWYDSHRSQILFSDPNSHS 88 >XP_016193453.1 PREDICTED: DNAJ protein JJJ1 homolog [Arachis ipaensis] Length = 615 Score = 166 bits (421), Expect = 5e-46 Identities = 79/90 (87%), Positives = 87/90 (96%) Frame = -3 Query: 273 AATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQ 94 A++ ASAKRCHYEVLGL RDCTP+EIRS+YRRLALQRHPDKLVQSG+SQSEATAQFQELQ Sbjct: 2 ASSSASAKRCHYEVLGLPRDCTPEEIRSAYRRLALQRHPDKLVQSGISQSEATAQFQELQ 61 Query: 93 QAYEVLSDPKERAWYDSHRSQILFSDPNSL 4 AYEVLSDPKER+WYDSHRSQILFSDP++L Sbjct: 62 HAYEVLSDPKERSWYDSHRSQILFSDPDTL 91 >KRH03127.1 hypothetical protein GLYMA_17G078100 [Glycine max] Length = 563 Score = 164 bits (416), Expect = 1e-45 Identities = 78/90 (86%), Positives = 85/90 (94%) Frame = -3 Query: 270 ATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQ 91 A+ ++AKRCHYEVLGL RDC PDEIRS+YRRLALQRHPDKLV+SGLSQ EATAQFQELQ Sbjct: 2 ASSSAAKRCHYEVLGLPRDCAPDEIRSAYRRLALQRHPDKLVKSGLSQEEATAQFQELQH 61 Query: 90 AYEVLSDPKERAWYDSHRSQILFSDPNSLS 1 AYEVLSDPKERAWYDSHRSQILFSDPN++S Sbjct: 62 AYEVLSDPKERAWYDSHRSQILFSDPNTVS 91 >XP_014630906.1 PREDICTED: dnaJ homolog subfamily C member 21-like isoform X2 [Glycine max] KRH56820.1 hypothetical protein GLYMA_05G021300 [Glycine max] Length = 586 Score = 164 bits (416), Expect = 2e-45 Identities = 78/90 (86%), Positives = 84/90 (93%) Frame = -3 Query: 270 ATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQ 91 A A+AKRCHYEVLGL RDC PDEIRS+YRRLALQRHPDKLV+SG+SQ EATAQFQELQ Sbjct: 2 AAAAAAKRCHYEVLGLPRDCAPDEIRSAYRRLALQRHPDKLVKSGISQEEATAQFQELQH 61 Query: 90 AYEVLSDPKERAWYDSHRSQILFSDPNSLS 1 AYEVLSDPKERAWYDSHRSQILFSDPN++S Sbjct: 62 AYEVLSDPKERAWYDSHRSQILFSDPNTVS 91 >XP_003524632.1 PREDICTED: dnaJ homolog subfamily C member 21-like isoform X1 [Glycine max] KRH56819.1 hypothetical protein GLYMA_05G021300 [Glycine max] Length = 620 Score = 164 bits (416), Expect = 3e-45 Identities = 78/90 (86%), Positives = 84/90 (93%) Frame = -3 Query: 270 ATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQ 91 A A+AKRCHYEVLGL RDC PDEIRS+YRRLALQRHPDKLV+SG+SQ EATAQFQELQ Sbjct: 2 AAAAAAKRCHYEVLGLPRDCAPDEIRSAYRRLALQRHPDKLVKSGISQEEATAQFQELQH 61 Query: 90 AYEVLSDPKERAWYDSHRSQILFSDPNSLS 1 AYEVLSDPKERAWYDSHRSQILFSDPN++S Sbjct: 62 AYEVLSDPKERAWYDSHRSQILFSDPNTVS 91 >XP_006600575.1 PREDICTED: dnaJ homolog subfamily C member 21-like [Glycine max] KRH03128.1 hypothetical protein GLYMA_17G078100 [Glycine max] Length = 626 Score = 164 bits (416), Expect = 3e-45 Identities = 78/90 (86%), Positives = 85/90 (94%) Frame = -3 Query: 270 ATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQ 91 A+ ++AKRCHYEVLGL RDC PDEIRS+YRRLALQRHPDKLV+SGLSQ EATAQFQELQ Sbjct: 2 ASSSAAKRCHYEVLGLPRDCAPDEIRSAYRRLALQRHPDKLVKSGLSQEEATAQFQELQH 61 Query: 90 AYEVLSDPKERAWYDSHRSQILFSDPNSLS 1 AYEVLSDPKERAWYDSHRSQILFSDPN++S Sbjct: 62 AYEVLSDPKERAWYDSHRSQILFSDPNTVS 91 >XP_019460506.1 PREDICTED: DNAJ protein JJJ1 homolog [Lupinus angustifolius] Length = 625 Score = 164 bits (414), Expect = 6e-45 Identities = 83/111 (74%), Positives = 91/111 (81%) Frame = -3 Query: 336 KIHRQPLNSEYAK*EP*LGAEAATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHP 157 K+H+Q LN + +MASAKRCHYEVLG+S D T DEIRS+YRRLALQRHP Sbjct: 5 KLHKQNLNPNLS----------LSMASAKRCHYEVLGVSLDSTADEIRSAYRRLALQRHP 54 Query: 156 DKLVQSGLSQSEATAQFQELQQAYEVLSDPKERAWYDSHRSQILFSDPNSL 4 DKLVQSG+SQSEATAQFQELQ AYEVLSDPKER WYDSHRSQILFSDPNS+ Sbjct: 55 DKLVQSGISQSEATAQFQELQHAYEVLSDPKERTWYDSHRSQILFSDPNSV 105 >XP_012080375.1 PREDICTED: dnaJ homolog subfamily C member 21 [Jatropha curcas] KDP31343.1 hypothetical protein JCGZ_11719 [Jatropha curcas] Length = 612 Score = 163 bits (412), Expect = 1e-44 Identities = 78/86 (90%), Positives = 83/86 (96%) Frame = -3 Query: 264 MASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAY 85 MAS KRCHYEVLGLS+DCT DEIRS+Y++LALQRHPDKLVQSGLSQ+EATAQFQEL QAY Sbjct: 1 MASEKRCHYEVLGLSQDCTADEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELAQAY 60 Query: 84 EVLSDPKERAWYDSHRSQILFSDPNS 7 EVLSDPKERAWYDSHRSQILFSDPNS Sbjct: 61 EVLSDPKERAWYDSHRSQILFSDPNS 86 >XP_007155239.1 hypothetical protein PHAVU_003G185100g [Phaseolus vulgaris] ESW27233.1 hypothetical protein PHAVU_003G185100g [Phaseolus vulgaris] Length = 627 Score = 162 bits (410), Expect = 2e-44 Identities = 78/91 (85%), Positives = 85/91 (93%) Frame = -3 Query: 273 AATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQ 94 A++ + AKRCHYEVL LS+DC P+EIRS+YRRLALQRHPDKLV+SGLSQ EATAQFQELQ Sbjct: 2 ASSSSLAKRCHYEVLDLSQDCAPEEIRSAYRRLALQRHPDKLVKSGLSQEEATAQFQELQ 61 Query: 93 QAYEVLSDPKERAWYDSHRSQILFSDPNSLS 1 AYEVLSDPKERAWYDSHRSQILFSDPNSLS Sbjct: 62 HAYEVLSDPKERAWYDSHRSQILFSDPNSLS 92 >EEF47765.1 conserved hypothetical protein [Ricinus communis] Length = 553 Score = 160 bits (406), Expect = 3e-44 Identities = 74/87 (85%), Positives = 84/87 (96%) Frame = -3 Query: 261 ASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAYE 82 AS KRCHYEVLGLSRDC+PDEIR++Y++LALQRHPDKL++SGLSQSEATAQFQEL QAYE Sbjct: 3 ASEKRCHYEVLGLSRDCSPDEIRAAYKKLALQRHPDKLIKSGLSQSEATAQFQELSQAYE 62 Query: 81 VLSDPKERAWYDSHRSQILFSDPNSLS 1 +LSDPKERAWYDSHRSQILFS+PN +S Sbjct: 63 ILSDPKERAWYDSHRSQILFSNPNDVS 89 >XP_007210718.1 hypothetical protein PRUPE_ppa022955mg [Prunus persica] Length = 521 Score = 160 bits (404), Expect = 4e-44 Identities = 74/85 (87%), Positives = 83/85 (97%) Frame = -3 Query: 261 ASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAYE 82 +S +RCHYEVLGLSRDC+PDEIRS+Y++LALQRHPDKLVQSGLSQ++ATAQFQEL QAYE Sbjct: 3 SSERRCHYEVLGLSRDCSPDEIRSAYKKLALQRHPDKLVQSGLSQAQATAQFQELSQAYE 62 Query: 81 VLSDPKERAWYDSHRSQILFSDPNS 7 VLSDPKERAWYDSHRSQILF+DPNS Sbjct: 63 VLSDPKERAWYDSHRSQILFADPNS 87 >XP_015943390.1 PREDICTED: DNAJ protein JJJ1 homolog [Arachis duranensis] Length = 615 Score = 161 bits (407), Expect = 5e-44 Identities = 77/90 (85%), Positives = 85/90 (94%) Frame = -3 Query: 273 AATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQ 94 A++ SAKRCHYEVLGL RD TP+EIRS+YRRLALQRHPDKLVQSG+SQSEATAQFQELQ Sbjct: 2 ASSSTSAKRCHYEVLGLPRDSTPEEIRSAYRRLALQRHPDKLVQSGISQSEATAQFQELQ 61 Query: 93 QAYEVLSDPKERAWYDSHRSQILFSDPNSL 4 AYEVLSDPKER+WYDSHRSQILFSDP++L Sbjct: 62 HAYEVLSDPKERSWYDSHRSQILFSDPDTL 91 >XP_004508679.1 PREDICTED: dnaJ homolog subfamily C member 21 [Cicer arietinum] Length = 657 Score = 161 bits (408), Expect = 6e-44 Identities = 79/89 (88%), Positives = 86/89 (96%), Gaps = 1/89 (1%) Frame = -3 Query: 264 MASAKRCHYEVLG-LSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQA 88 MASAKRCHYEVLG +SRDC+P+EIRS+YR+LALQRHPDKLV+SGLSQ+EATAQFQELQ A Sbjct: 1 MASAKRCHYEVLGGISRDCSPEEIRSAYRKLALQRHPDKLVKSGLSQAEATAQFQELQHA 60 Query: 87 YEVLSDPKERAWYDSHRSQILFSDPNSLS 1 YEVLSDPKERAWYDSHRSQILFSDPNS S Sbjct: 61 YEVLSDPKERAWYDSHRSQILFSDPNSHS 89 >XP_015572095.1 PREDICTED: dnaJ homolog subfamily C member 21 [Ricinus communis] Length = 601 Score = 160 bits (406), Expect = 6e-44 Identities = 74/87 (85%), Positives = 84/87 (96%) Frame = -3 Query: 261 ASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAYE 82 AS KRCHYEVLGLSRDC+PDEIR++Y++LALQRHPDKL++SGLSQSEATAQFQEL QAYE Sbjct: 3 ASEKRCHYEVLGLSRDCSPDEIRAAYKKLALQRHPDKLIKSGLSQSEATAQFQELSQAYE 62 Query: 81 VLSDPKERAWYDSHRSQILFSDPNSLS 1 +LSDPKERAWYDSHRSQILFS+PN +S Sbjct: 63 ILSDPKERAWYDSHRSQILFSNPNDVS 89 >OIW18519.1 hypothetical protein TanjilG_13271 [Lupinus angustifolius] Length = 607 Score = 160 bits (406), Expect = 7e-44 Identities = 78/87 (89%), Positives = 82/87 (94%) Frame = -3 Query: 264 MASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAY 85 MASAKRCHYEVLG+S D T DEIRS+YRRLALQRHPDKLVQSG+SQSEATAQFQELQ AY Sbjct: 1 MASAKRCHYEVLGVSLDSTADEIRSAYRRLALQRHPDKLVQSGISQSEATAQFQELQHAY 60 Query: 84 EVLSDPKERAWYDSHRSQILFSDPNSL 4 EVLSDPKER WYDSHRSQILFSDPNS+ Sbjct: 61 EVLSDPKERTWYDSHRSQILFSDPNSV 87 >XP_014510461.1 PREDICTED: dnaJ homolog subfamily C member 21 isoform X2 [Vigna radiata var. radiata] Length = 614 Score = 160 bits (406), Expect = 7e-44 Identities = 76/91 (83%), Positives = 85/91 (93%) Frame = -3 Query: 273 AATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQ 94 A++ + AKRCHYEVL L +DC+P+EIRSSYRRLALQRHPDKL++SG+SQ EATAQFQELQ Sbjct: 2 ASSSSLAKRCHYEVLDLPQDCSPEEIRSSYRRLALQRHPDKLIKSGISQEEATAQFQELQ 61 Query: 93 QAYEVLSDPKERAWYDSHRSQILFSDPNSLS 1 AYEVLSDPKERAWYDSHRSQILFSDPNSLS Sbjct: 62 HAYEVLSDPKERAWYDSHRSQILFSDPNSLS 92 >XP_004138317.1 PREDICTED: dnaJ homolog subfamily C member 21 [Cucumis sativus] KGN63724.1 hypothetical protein Csa_1G013230 [Cucumis sativus] Length = 588 Score = 160 bits (405), Expect = 7e-44 Identities = 77/88 (87%), Positives = 83/88 (94%) Frame = -3 Query: 264 MASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAY 85 MASAKRCHYEVLGL DCTPDEIRS+YR+LALQRHPDKLVQSGLSQ++ATAQFQELQ AY Sbjct: 1 MASAKRCHYEVLGLHIDCTPDEIRSAYRKLALQRHPDKLVQSGLSQADATAQFQELQHAY 60 Query: 84 EVLSDPKERAWYDSHRSQILFSDPNSLS 1 EVLSDPKERAWYDSHRSQILFSD S++ Sbjct: 61 EVLSDPKERAWYDSHRSQILFSDAGSVN 88 >XP_014510460.1 PREDICTED: dnaJ homolog subfamily C member 21 isoform X1 [Vigna radiata var. radiata] Length = 651 Score = 160 bits (406), Expect = 1e-43 Identities = 76/91 (83%), Positives = 85/91 (93%) Frame = -3 Query: 273 AATMASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQ 94 A++ + AKRCHYEVL L +DC+P+EIRSSYRRLALQRHPDKL++SG+SQ EATAQFQELQ Sbjct: 2 ASSSSLAKRCHYEVLDLPQDCSPEEIRSSYRRLALQRHPDKLIKSGISQEEATAQFQELQ 61 Query: 93 QAYEVLSDPKERAWYDSHRSQILFSDPNSLS 1 AYEVLSDPKERAWYDSHRSQILFSDPNSLS Sbjct: 62 HAYEVLSDPKERAWYDSHRSQILFSDPNSLS 92 >XP_008240022.1 PREDICTED: DNAJ protein JJJ1 homolog [Prunus mume] Length = 603 Score = 160 bits (404), Expect = 1e-43 Identities = 74/85 (87%), Positives = 83/85 (97%) Frame = -3 Query: 261 ASAKRCHYEVLGLSRDCTPDEIRSSYRRLALQRHPDKLVQSGLSQSEATAQFQELQQAYE 82 +S +RCHYEVLGL+RDC+PDEIRSSY++LALQRHPDKLVQSGLSQ++ATAQFQEL QAYE Sbjct: 3 SSERRCHYEVLGLARDCSPDEIRSSYKKLALQRHPDKLVQSGLSQAQATAQFQELSQAYE 62 Query: 81 VLSDPKERAWYDSHRSQILFSDPNS 7 VLSDPKERAWYDSHRSQILF+DPNS Sbjct: 63 VLSDPKERAWYDSHRSQILFADPNS 87