BLASTX nr result
ID: Glycyrrhiza30_contig00020506
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00020506 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003620744.1 hypothetical protein MTR_6g089920 [Medicago trunc... 72 3e-14 XP_013452764.1 rhoptry associated membrane antigen, putative [Me... 55 5e-07 >XP_003620744.1 hypothetical protein MTR_6g089920 [Medicago truncatula] AES76962.1 hypothetical protein MTR_6g089920 [Medicago truncatula] Length = 134 Score = 72.0 bits (175), Expect = 3e-14 Identities = 40/77 (51%), Positives = 55/77 (71%), Gaps = 13/77 (16%) Frame = -3 Query: 192 SNDVEEIQKLLEQLKIIEDDNNQI--QKIDKNQTPKEKNENEEIILAYTSS--------- 46 SND+EEI++L+EQLKI+E++N I +K++K +T K ENEE+IL Y SS Sbjct: 15 SNDIEEIKQLMEQLKIVEEENKPISLEKVEKIET---KEENEEVILNYNSSDLEYEIGSN 71 Query: 45 --SDSEYDEIFMEKGET 1 SDS++DEIFME+GET Sbjct: 72 VGSDSDFDEIFMERGET 88 >XP_013452764.1 rhoptry associated membrane antigen, putative [Medicago truncatula] KEH26792.1 rhoptry associated membrane antigen, putative [Medicago truncatula] Length = 289 Score = 55.1 bits (131), Expect = 5e-07 Identities = 36/99 (36%), Positives = 50/99 (50%), Gaps = 35/99 (35%) Frame = -3 Query: 192 SNDVEEIQKLLEQLKIIEDDNNQIQKI------DKNQ-----TPKEKNENEEIILAYTSS 46 SND+ +I + EQLKI+E +N IQK+ D N+ T E+ +NEE+IL YT+S Sbjct: 37 SNDINKILQSFEQLKIVEKENKNIQKLEPAETSDDNEVTLGYTTSEELDNEEVILGYTTS 96 Query: 45 ------------------------SDSEYDEIFMEKGET 1 +S YD+IF+EKGET Sbjct: 97 EESYINEEEAKYCISSDEFDHLEREESNYDQIFIEKGET 135