BLASTX nr result
ID: Glycyrrhiza30_contig00020340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00020340 (559 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP72900.1 hypothetical protein KK1_005504 [Cajanus cajan] 112 3e-28 KOM49737.1 hypothetical protein LR48_Vigan08g056400 [Vigna angul... 111 3e-26 XP_017431528.1 PREDICTED: zinc finger CCCH domain-containing pro... 111 7e-26 BAT89670.1 hypothetical protein VIGAN_06068800 [Vigna angularis ... 111 7e-26 XP_017437676.1 PREDICTED: zinc finger CCCH domain-containing pro... 110 7e-26 KOM56864.1 hypothetical protein LR48_Vigan10g275600 [Vigna angul... 110 1e-25 XP_017437675.1 PREDICTED: zinc finger CCCH domain-containing pro... 110 2e-25 XP_017437674.1 PREDICTED: zinc finger CCCH domain-containing pro... 110 2e-25 XP_007142216.1 hypothetical protein PHAVU_008G261900g [Phaseolus... 110 3e-25 XP_014503596.1 PREDICTED: zinc finger CCCH domain-containing pro... 109 4e-25 NP_001241083.1 uncharacterized protein LOC100792988 [Glycine max... 100 3e-24 GAU49650.1 hypothetical protein TSUD_245570 [Trifolium subterran... 103 6e-24 XP_004490592.1 PREDICTED: zinc finger CCCH domain-containing pro... 104 3e-23 KHN46158.1 Zinc finger CCCH domain-containing protein 25 [Glycin... 100 1e-22 XP_003615614.1 RNA recognition motif (RRM) containing protein [M... 102 2e-22 XP_006574417.1 PREDICTED: uncharacterized protein LOC100792988 i... 100 1e-21 XP_016166201.1 PREDICTED: zinc finger CCCH domain-containing pro... 91 4e-18 XP_015937489.1 PREDICTED: zinc finger CCCH domain-containing pro... 91 4e-18 GAU25501.1 hypothetical protein TSUD_279840 [Trifolium subterran... 84 4e-18 XP_019431841.1 PREDICTED: zinc finger CCCH domain-containing pro... 84 1e-15 >KYP72900.1 hypothetical protein KK1_005504 [Cajanus cajan] Length = 165 Score = 112 bits (280), Expect = 3e-28 Identities = 54/64 (84%), Positives = 57/64 (89%) Frame = +1 Query: 4 RSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREEK 183 +SRE HSNREDRRSRKHT DESAPRSREDYDRKQDNRS+RND DR+ESK R DFD REEK Sbjct: 102 KSREPHSNREDRRSRKHTEDESAPRSREDYDRKQDNRSHRNDRDRTESKARYDFDTREEK 161 Query: 184 RSGR 195 RS R Sbjct: 162 RSRR 165 >KOM49737.1 hypothetical protein LR48_Vigan08g056400 [Vigna angularis] Length = 329 Score = 111 bits (278), Expect = 3e-26 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S++RE HSNREDRRSRKH+ DESAPRSREDYDRKQDNR YR+D+DR ESK+R DF+RREE Sbjct: 265 SKAREPHSNREDRRSRKHSEDESAPRSREDYDRKQDNRFYRSDSDRPESKVRHDFERREE 324 Query: 181 KRSGR 195 KRS R Sbjct: 325 KRSRR 329 >XP_017431528.1 PREDICTED: zinc finger CCCH domain-containing protein 25-like [Vigna angularis] Length = 394 Score = 111 bits (278), Expect = 7e-26 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S++RE HSNREDRRSRKH+ DESAPRSREDYDRKQDNR YR+D+DR ESK+R DF+RREE Sbjct: 330 SKAREPHSNREDRRSRKHSEDESAPRSREDYDRKQDNRFYRSDSDRPESKVRHDFERREE 389 Query: 181 KRSGR 195 KRS R Sbjct: 390 KRSRR 394 >BAT89670.1 hypothetical protein VIGAN_06068800 [Vigna angularis var. angularis] Length = 394 Score = 111 bits (278), Expect = 7e-26 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S++RE HSNREDRRSRKH+ DESAPRSREDYDRKQDNR YR+D+DR ESK+R DF+RREE Sbjct: 330 SKAREPHSNREDRRSRKHSEDESAPRSREDYDRKQDNRFYRSDSDRPESKVRHDFERREE 389 Query: 181 KRSGR 195 KRS R Sbjct: 390 KRSRR 394 >XP_017437676.1 PREDICTED: zinc finger CCCH domain-containing protein 25 isoform X3 [Vigna angularis] Length = 329 Score = 110 bits (275), Expect = 7e-26 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S++RE HSNREDR+SRKH+ DESAPRSREDYDRKQDNR YR+D+DR ESK+R DF+RREE Sbjct: 265 SKAREPHSNREDRKSRKHSEDESAPRSREDYDRKQDNRFYRSDSDRPESKVRHDFERREE 324 Query: 181 KRSGR 195 KRS R Sbjct: 325 KRSRR 329 >KOM56864.1 hypothetical protein LR48_Vigan10g275600 [Vigna angularis] Length = 361 Score = 110 bits (275), Expect = 1e-25 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S++RE HSNREDR+SRKH+ DESAPRSREDYDRKQDNR YR+D+DR ESK+R DF+RREE Sbjct: 297 SKAREPHSNREDRKSRKHSEDESAPRSREDYDRKQDNRFYRSDSDRPESKVRHDFERREE 356 Query: 181 KRSGR 195 KRS R Sbjct: 357 KRSRR 361 >XP_017437675.1 PREDICTED: zinc finger CCCH domain-containing protein 25 isoform X2 [Vigna angularis] Length = 386 Score = 110 bits (275), Expect = 2e-25 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S++RE HSNREDR+SRKH+ DESAPRSREDYDRKQDNR YR+D+DR ESK+R DF+RREE Sbjct: 322 SKAREPHSNREDRKSRKHSEDESAPRSREDYDRKQDNRFYRSDSDRPESKVRHDFERREE 381 Query: 181 KRSGR 195 KRS R Sbjct: 382 KRSRR 386 >XP_017437674.1 PREDICTED: zinc finger CCCH domain-containing protein 25 isoform X1 [Vigna angularis] BAT81547.1 hypothetical protein VIGAN_03129400 [Vigna angularis var. angularis] Length = 394 Score = 110 bits (275), Expect = 2e-25 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S++RE HSNREDR+SRKH+ DESAPRSREDYDRKQDNR YR+D+DR ESK+R DF+RREE Sbjct: 330 SKAREPHSNREDRKSRKHSEDESAPRSREDYDRKQDNRFYRSDSDRPESKVRHDFERREE 389 Query: 181 KRSGR 195 KRS R Sbjct: 390 KRSRR 394 >XP_007142216.1 hypothetical protein PHAVU_008G261900g [Phaseolus vulgaris] ESW14210.1 hypothetical protein PHAVU_008G261900g [Phaseolus vulgaris] Length = 395 Score = 110 bits (274), Expect = 3e-25 Identities = 52/65 (80%), Positives = 57/65 (87%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S +RE HSNREDRRSRKH+ DESAPRSREDYDRK DNR YRND+DR ESK+R DF+RREE Sbjct: 331 SNAREPHSNREDRRSRKHSEDESAPRSREDYDRKLDNRLYRNDSDRPESKVRHDFERREE 390 Query: 181 KRSGR 195 KRS R Sbjct: 391 KRSRR 395 >XP_014503596.1 PREDICTED: zinc finger CCCH domain-containing protein 25 [Vigna radiata var. radiata] Length = 393 Score = 109 bits (273), Expect = 4e-25 Identities = 51/65 (78%), Positives = 58/65 (89%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S++RE H NREDRRSRKH+ DESAPRSREDYDRKQDNR YR+D+DR ESK+R DF+RREE Sbjct: 329 SKAREPHRNREDRRSRKHSEDESAPRSREDYDRKQDNRFYRSDSDRPESKVRHDFERREE 388 Query: 181 KRSGR 195 KRS R Sbjct: 389 KRSRR 393 >NP_001241083.1 uncharacterized protein LOC100792988 [Glycine max] ACU19889.1 unknown [Glycine max] Length = 119 Score = 100 bits (250), Expect = 3e-24 Identities = 49/65 (75%), Positives = 55/65 (84%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S+SRE HSNRED RSRKH DESAP+SRE+Y RKQD+RSYRND+ R+ESK R DFDRREE Sbjct: 55 SKSREPHSNREDMRSRKHGEDESAPKSRENYARKQDDRSYRNDSSRTESKERYDFDRREE 114 Query: 181 KRSGR 195 KR R Sbjct: 115 KRPRR 119 >GAU49650.1 hypothetical protein TSUD_245570 [Trifolium subterraneum] Length = 239 Score = 103 bits (257), Expect = 6e-24 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S+SRE H NR++RRSRKH DES PRSRED+DRKQDNRSYRNDTDRSESK R + +RREE Sbjct: 176 SKSRE-HGNRDERRSRKHVEDESVPRSREDHDRKQDNRSYRNDTDRSESKGRYESERREE 234 Query: 181 KRSGR 195 KRSGR Sbjct: 235 KRSGR 239 >XP_004490592.1 PREDICTED: zinc finger CCCH domain-containing protein 25 [Cicer arietinum] Length = 396 Score = 104 bits (260), Expect = 3e-23 Identities = 52/65 (80%), Positives = 56/65 (86%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S+SRET NRE++RSRKHT DES PRSRED DRKQDNRSY+ DTDRSESK R D DRREE Sbjct: 332 SKSRETLGNREEKRSRKHTEDESVPRSREDRDRKQDNRSYKIDTDRSESKGRYDSDRREE 391 Query: 181 KRSGR 195 KRSGR Sbjct: 392 KRSGR 396 >KHN46158.1 Zinc finger CCCH domain-containing protein 25 [Glycine soja] Length = 280 Score = 100 bits (250), Expect = 1e-22 Identities = 49/65 (75%), Positives = 55/65 (84%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S+SRE HSNRED RSRKH DESAP+SRE+Y RKQD+RSYRND+ R+ESK R DFDRREE Sbjct: 216 SKSREPHSNREDMRSRKHGEDESAPKSRENYARKQDDRSYRNDSSRTESKERYDFDRREE 275 Query: 181 KRSGR 195 KR R Sbjct: 276 KRPRR 280 >XP_003615614.1 RNA recognition motif (RRM) containing protein [Medicago truncatula] AES98572.1 RNA recognition motif (RRM) containing protein [Medicago truncatula] Length = 393 Score = 102 bits (254), Expect = 2e-22 Identities = 50/65 (76%), Positives = 55/65 (84%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S+SRET +RE+RRSRKHT DES PRSRED+DRKQDNRSY D DRSESK R+D DRREE Sbjct: 329 SKSRETQGSREERRSRKHTDDESMPRSREDHDRKQDNRSYHKDADRSESKGRNDSDRREE 388 Query: 181 KRSGR 195 KRS R Sbjct: 389 KRSRR 393 >XP_006574417.1 PREDICTED: uncharacterized protein LOC100792988 isoform X1 [Glycine max] KRH72666.1 hypothetical protein GLYMA_02G226100 [Glycine max] Length = 442 Score = 100 bits (250), Expect = 1e-21 Identities = 49/65 (75%), Positives = 55/65 (84%) Frame = +1 Query: 1 SRSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREE 180 S+SRE HSNRED RSRKH DESAP+SRE+Y RKQD+RSYRND+ R+ESK R DFDRREE Sbjct: 378 SKSREPHSNREDMRSRKHGEDESAPKSRENYARKQDDRSYRNDSSRTESKERYDFDRREE 437 Query: 181 KRSGR 195 KR R Sbjct: 438 KRPRR 442 >XP_016166201.1 PREDICTED: zinc finger CCCH domain-containing protein 25 [Arachis ipaensis] Length = 424 Score = 90.9 bits (224), Expect = 4e-18 Identities = 41/57 (71%), Positives = 51/57 (89%) Frame = +1 Query: 25 NREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREEKRSGR 195 NRE+RRSRKH ++ AP+SREDYDRK++NRSYRND+DRS+ K R+DFDRR+EKRS R Sbjct: 368 NREERRSRKHNEEDYAPQSREDYDRKRENRSYRNDSDRSDPKGRNDFDRRDEKRSRR 424 >XP_015937489.1 PREDICTED: zinc finger CCCH domain-containing protein 25-like [Arachis duranensis] Length = 424 Score = 90.9 bits (224), Expect = 4e-18 Identities = 41/57 (71%), Positives = 51/57 (89%) Frame = +1 Query: 25 NREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREEKRSGR 195 NRE+RRSRKH ++ APRSREDYD+K++NRSYRND+DRS+ K R+DFDRR+EKRS R Sbjct: 368 NREERRSRKHDEEDYAPRSREDYDKKRENRSYRNDSDRSDPKGRNDFDRRDEKRSRR 424 >GAU25501.1 hypothetical protein TSUD_279840 [Trifolium subterraneum] Length = 69 Score = 83.6 bits (205), Expect = 4e-18 Identities = 44/62 (70%), Positives = 48/62 (77%) Frame = +2 Query: 20 IVTGKTGDRESTLQMNLHQGQEKTMIGSKITDHIEMILIDQNQK*DPILTGEKRRGQEGN 199 +VTGK GD+ESTL+ NL QGQEK MIGSKI D IEMILID N K D L EK+RG EGN Sbjct: 1 MVTGKRGDQESTLKTNLCQGQEKIMIGSKIEDRIEMILIDLNLKEDMNLNEEKKRGPEGN 60 Query: 200 DN 205 DN Sbjct: 61 DN 62 >XP_019431841.1 PREDICTED: zinc finger CCCH domain-containing protein 25 [Lupinus angustifolius] OIW16509.1 hypothetical protein TanjilG_32179 [Lupinus angustifolius] Length = 390 Score = 83.6 bits (205), Expect = 1e-15 Identities = 45/64 (70%), Positives = 51/64 (79%) Frame = +1 Query: 4 RSRETHSNREDRRSRKHTADESAPRSREDYDRKQDNRSYRNDTDRSESKIRSDFDRREEK 183 RSRE H NRE+RRSRK DES PRS+EDYDRKQD+RSYR T +S+SK+R D D REEK Sbjct: 330 RSREAHINREERRSRKDNEDESVPRSKEDYDRKQDSRSYR--TYQSQSKVRYD-DVREEK 386 Query: 184 RSGR 195 RS R Sbjct: 387 RSRR 390