BLASTX nr result
ID: Glycyrrhiza30_contig00019842
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00019842 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY42871.1 hypothetical protein MANES_08G022800 [Manihot esculenta] 68 4e-12 XP_012066454.1 PREDICTED: protein BUD31 homolog 2 isoform X1 [Ja... 68 8e-12 XP_014522581.1 PREDICTED: protein BUD31 homolog 2-like [Vigna ra... 66 1e-11 OMO95770.1 G10 protein [Corchorus capsularis] OMP07240.1 G10 pro... 66 2e-11 XP_018839780.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia... 66 2e-11 XP_018839767.1 PREDICTED: protein BUD31 homolog 2-like [Juglans ... 66 2e-11 XP_015901947.1 PREDICTED: protein BUD31 homolog 2 [Ziziphus jujuba] 66 2e-11 XP_011094396.1 PREDICTED: protein BUD31 homolog 2-like [Sesamum ... 66 2e-11 XP_011077892.1 PREDICTED: protein BUD31 homolog 2 [Sesamum indicum] 66 2e-11 XP_012475822.1 PREDICTED: protein BUD31 homolog 2 [Gossypium rai... 66 2e-11 XP_010049717.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus gr... 66 2e-11 XP_009365750.1 PREDICTED: protein BUD31 homolog 1 [Pyrus x brets... 66 2e-11 XP_009365369.1 PREDICTED: protein BUD31 homolog 1-like [Pyrus x ... 66 2e-11 XP_008238057.1 PREDICTED: protein BUD31 homolog 1-like [Prunus m... 66 2e-11 XP_012836106.1 PREDICTED: protein BUD31 homolog 2 [Erythranthe g... 66 2e-11 XP_007039701.1 PREDICTED: protein BUD31 homolog 2 [Theobroma cac... 66 2e-11 NP_001237676.1 uncharacterized protein LOC100305597 [Glycine max... 66 2e-11 KYP54868.1 Protein BUD31 isogeny 2 [Cajanus cajan] 64 3e-11 KVH99901.1 G10 protein [Cynara cardunculus var. scolymus] 64 3e-11 KCW89225.1 hypothetical protein EUGRSUZ_A01529 [Eucalyptus grand... 67 3e-11 >OAY42871.1 hypothetical protein MANES_08G022800 [Manihot esculenta] Length = 150 Score = 67.8 bits (164), Expect = 4e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 226 KMPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 KMPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 5 KMPKVKTNRVKYPEGWELIEPTLRELQAKMR 35 >XP_012066454.1 PREDICTED: protein BUD31 homolog 2 isoform X1 [Jatropha curcas] Length = 189 Score = 67.8 bits (164), Expect = 8e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 208 IGKER*KMPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 I K++ +MPKVKTNRVKYPEGWELIEPTLRELQ+KMR Sbjct: 38 IKKKKQRMPKVKTNRVKYPEGWELIEPTLRELQSKMR 74 >XP_014522581.1 PREDICTED: protein BUD31 homolog 2-like [Vigna radiata var. radiata] Length = 115 Score = 65.9 bits (159), Expect = 1e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >OMO95770.1 G10 protein [Corchorus capsularis] OMP07240.1 G10 protein [Corchorus olitorius] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_018839780.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839781.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839783.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839784.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839785.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839786.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839787.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_018839767.1 PREDICTED: protein BUD31 homolog 2-like [Juglans regia] XP_018839768.1 PREDICTED: protein BUD31 homolog 2-like [Juglans regia] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_015901947.1 PREDICTED: protein BUD31 homolog 2 [Ziziphus jujuba] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_011094396.1 PREDICTED: protein BUD31 homolog 2-like [Sesamum indicum] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_011077892.1 PREDICTED: protein BUD31 homolog 2 [Sesamum indicum] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_012475822.1 PREDICTED: protein BUD31 homolog 2 [Gossypium raimondii] XP_016716203.1 PREDICTED: protein BUD31 homolog 2 [Gossypium hirsutum] XP_016703313.1 PREDICTED: protein BUD31 homolog 2 [Gossypium hirsutum] XP_017624217.1 PREDICTED: protein BUD31 homolog 2 [Gossypium arboreum] KHG22385.1 hypothetical protein F383_27796 [Gossypium arboreum] KJB25466.1 hypothetical protein B456_004G193300 [Gossypium raimondii] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_010049717.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] XP_018730114.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] XP_018730118.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] XP_018730121.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] XP_018730122.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_009365750.1 PREDICTED: protein BUD31 homolog 1 [Pyrus x bretschneideri] XP_009374754.1 PREDICTED: protein BUD31 homolog 1 [Pyrus x bretschneideri] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_009365369.1 PREDICTED: protein BUD31 homolog 1-like [Pyrus x bretschneideri] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_008238057.1 PREDICTED: protein BUD31 homolog 1-like [Prunus mume] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_012836106.1 PREDICTED: protein BUD31 homolog 2 [Erythranthe guttata] EYU38622.1 hypothetical protein MIMGU_mgv1a015799mg [Erythranthe guttata] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_007039701.1 PREDICTED: protein BUD31 homolog 2 [Theobroma cacao] EOY24202.1 G10 family protein [Theobroma cacao] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >NP_001237676.1 uncharacterized protein LOC100305597 [Glycine max] XP_003524924.1 PREDICTED: protein BUD31 homolog 2 [Glycine max] XP_007160948.1 hypothetical protein PHAVU_001G030700g [Phaseolus vulgaris] XP_014503731.1 PREDICTED: protein BUD31 homolog 2 [Vigna radiata var. radiata] XP_014633798.1 PREDICTED: uncharacterized protein LOC100305597 isoform X1 [Glycine max] XP_015958231.1 PREDICTED: protein BUD31 homolog 2 [Arachis duranensis] XP_016187703.1 PREDICTED: protein BUD31 homolog 2 [Arachis ipaensis] XP_017428294.1 PREDICTED: protein BUD31 homolog 2 [Vigna angularis] XP_017428295.1 PREDICTED: protein BUD31 homolog 2 [Vigna angularis] XP_017428296.1 PREDICTED: protein BUD31 homolog 2 [Vigna angularis] ACU13359.1 unknown [Glycine max] ESW32942.1 hypothetical protein PHAVU_001G030700g [Phaseolus vulgaris] KHN12347.1 Protein BUD31 like 2 [Glycine soja] KOM48926.1 hypothetical protein LR48_Vigan07g263000 [Vigna angularis] KRH42745.1 hypothetical protein GLYMA_08G108500 [Glycine max] KRH42746.1 hypothetical protein GLYMA_08G108500 [Glycine max] KRH42747.1 hypothetical protein GLYMA_08G108500 [Glycine max] KRH58844.1 hypothetical protein GLYMA_05G151700 [Glycine max] BAT82572.1 hypothetical protein VIGAN_03261100 [Vigna angularis var. angularis] Length = 145 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >KYP54868.1 Protein BUD31 isogeny 2 [Cajanus cajan] Length = 96 Score = 64.3 bits (155), Expect = 3e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQ KMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQGKMR 30 >KVH99901.1 G10 protein [Cynara cardunculus var. scolymus] Length = 96 Score = 64.3 bits (155), Expect = 3e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 229 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 MPKVKTNRVKYPEGWELIEPTLRELQ KMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQGKMR 30 >KCW89225.1 hypothetical protein EUGRSUZ_A01529 [Eucalyptus grandis] KCW89226.1 hypothetical protein EUGRSUZ_A01529 [Eucalyptus grandis] KCW89227.1 hypothetical protein EUGRSUZ_A01529 [Eucalyptus grandis] KCW89228.1 hypothetical protein EUGRSUZ_A01529 [Eucalyptus grandis] Length = 218 Score = 67.0 bits (162), Expect = 3e-11 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +1 Query: 193 SEQSEIGKER*KMPKVKTNRVKYPEGWELIEPTLRELQAKMR 318 S + + ++ MPKVKTNRVKYPEGWELIEPTLRELQAKMR Sbjct: 62 SGRKSLSRQGISMPKVKTNRVKYPEGWELIEPTLRELQAKMR 103