BLASTX nr result
ID: Glycyrrhiza30_contig00019283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00019283 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013451530.1 cationic amino acid transporter 2, vacuolar prote... 53 4e-06 XP_013451529.1 cationic amino acid transporter 2, vacuolar prote... 53 4e-06 GAU44241.1 hypothetical protein TSUD_139340 [Trifolium subterran... 52 7e-06 >XP_013451530.1 cationic amino acid transporter 2, vacuolar protein [Medicago truncatula] KEH25558.1 cationic amino acid transporter 2, vacuolar protein [Medicago truncatula] Length = 582 Score = 52.8 bits (125), Expect = 4e-06 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 2/36 (5%) Frame = +1 Query: 139 SCSWRFLTRRKKVDSAN-ENNNSESHG-QLAKELTV 240 SCSWRFLTRRKKVD+++ EN N SHG QLAKELTV Sbjct: 14 SCSWRFLTRRKKVDNSHVENINKNSHGVQLAKELTV 49 >XP_013451529.1 cationic amino acid transporter 2, vacuolar protein [Medicago truncatula] KEH25557.1 cationic amino acid transporter 2, vacuolar protein [Medicago truncatula] Length = 628 Score = 52.8 bits (125), Expect = 4e-06 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 2/36 (5%) Frame = +1 Query: 139 SCSWRFLTRRKKVDSAN-ENNNSESHG-QLAKELTV 240 SCSWRFLTRRKKVD+++ EN N SHG QLAKELTV Sbjct: 14 SCSWRFLTRRKKVDNSHVENINKNSHGVQLAKELTV 49 >GAU44241.1 hypothetical protein TSUD_139340 [Trifolium subterraneum] Length = 427 Score = 52.0 bits (123), Expect = 7e-06 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 4/38 (10%) Frame = +1 Query: 139 SCSWRFLTRRKKVDS--ANENNNSESH--GQLAKELTV 240 SCSW+FLTRRKKVDS N NNN SH QLAKELTV Sbjct: 23 SCSWKFLTRRKKVDSNVTNNNNNDNSHHGEQLAKELTV 60