BLASTX nr result
ID: Glycyrrhiza30_contig00019161
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00019161 (548 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013464690.1 VQ motif protein [Medicago truncatula] ACJ85125.1... 68 2e-10 ACJ84515.1 unknown [Medicago truncatula] 68 2e-10 AFK35557.1 unknown [Medicago truncatula] 68 2e-10 GAU33737.1 hypothetical protein TSUD_52700 [Trifolium subterraneum] 67 2e-10 XP_004141221.1 PREDICTED: VQ motif-containing protein 19 [Cucumi... 66 9e-10 XP_008452447.1 PREDICTED: VQ motif-containing protein 4 [Cucumis... 66 9e-10 XP_015887393.1 PREDICTED: VQ motif-containing protein 4 [Ziziphu... 66 1e-09 KYP58854.1 hypothetical protein KK1_014276 [Cajanus cajan] 65 2e-09 XP_016703019.1 PREDICTED: VQ motif-containing protein 19-like [G... 65 2e-09 XP_012458197.1 PREDICTED: VQ motif-containing protein 19 [Gossyp... 65 2e-09 XP_017639494.1 PREDICTED: VQ motif-containing protein 19-like [G... 65 2e-09 KHG22617.1 hypothetical protein F383_03340 [Gossypium arboreum] 65 2e-09 XP_018850672.1 PREDICTED: VQ motif-containing protein 4-like [Ju... 65 2e-09 OMO73275.1 VQ motif-containing protein [Corchorus olitorius] 65 3e-09 OMO55639.1 VQ motif-containing protein [Corchorus capsularis] 65 3e-09 XP_019425886.1 PREDICTED: VQ motif-containing protein 4-like [Lu... 64 3e-09 ACU18161.1 unknown, partial [Glycine max] 64 4e-09 GAV72309.1 VQ domain-containing protein [Cephalotus follicularis] 64 4e-09 XP_012441422.1 PREDICTED: VQ motif-containing protein 4-like [Go... 64 5e-09 XP_017612914.1 PREDICTED: VQ motif-containing protein 4-like [Go... 64 5e-09 >XP_013464690.1 VQ motif protein [Medicago truncatula] ACJ85125.1 unknown [Medicago truncatula] KEH38725.1 VQ motif protein [Medicago truncatula] Length = 246 Score = 67.8 bits (164), Expect = 2e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQPPT 547 RSDSNPYPTTFVQADTTTFK VVQ+LTGSSET PT Sbjct: 57 RSDSNPYPTTFVQADTTTFKQVVQMLTGSSETTSTTPT 94 >ACJ84515.1 unknown [Medicago truncatula] Length = 246 Score = 67.8 bits (164), Expect = 2e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQPPT 547 RSDSNPYPTTFVQADTTTFK VVQ+LTGSSET PT Sbjct: 57 RSDSNPYPTTFVQADTTTFKQVVQMLTGSSETTSTTPT 94 >AFK35557.1 unknown [Medicago truncatula] Length = 249 Score = 67.8 bits (164), Expect = 2e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQPPT 547 RSDSNPYPTTFVQADTTTFK VVQ+LTGSSET PT Sbjct: 57 RSDSNPYPTTFVQADTTTFKQVVQMLTGSSETTSTTPT 94 >GAU33737.1 hypothetical protein TSUD_52700 [Trifolium subterraneum] Length = 245 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQPPT 547 RSDSNPYPTTFVQADTTTFK VVQ+LTGSSET P T Sbjct: 52 RSDSNPYPTTFVQADTTTFKQVVQMLTGSSETPTTPTT 89 >XP_004141221.1 PREDICTED: VQ motif-containing protein 19 [Cucumis sativus] KGN55122.1 hypothetical protein Csa_4G637130 [Cucumis sativus] Length = 246 Score = 65.9 bits (159), Expect = 9e-10 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 3/41 (7%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSET---KQQPPT 547 RSDSNPYPTTFVQADT+ FKHVVQ+LTGSSE+ Q PPT Sbjct: 46 RSDSNPYPTTFVQADTSNFKHVVQMLTGSSESPRPPQHPPT 86 >XP_008452447.1 PREDICTED: VQ motif-containing protein 4 [Cucumis melo] Length = 247 Score = 65.9 bits (159), Expect = 9e-10 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 3/41 (7%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSET---KQQPPT 547 RSDSNPYPTTFVQADT+ FKHVVQ+LTGSSE+ Q PPT Sbjct: 47 RSDSNPYPTTFVQADTSNFKHVVQMLTGSSESPRPPQHPPT 87 >XP_015887393.1 PREDICTED: VQ motif-containing protein 4 [Ziziphus jujuba] Length = 254 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ 538 RSDSNPYPTTFVQADT++FKHVVQ+LTGSSET +Q Sbjct: 50 RSDSNPYPTTFVQADTSSFKHVVQMLTGSSETLKQ 84 >KYP58854.1 hypothetical protein KK1_014276 [Cajanus cajan] Length = 237 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSE-TKQQPP 544 RSDSNPYPTTFVQADT+TFK VVQ+LTGSS+ TKQQ P Sbjct: 59 RSDSNPYPTTFVQADTSTFKQVVQMLTGSSDTTKQQDP 96 >XP_016703019.1 PREDICTED: VQ motif-containing protein 19-like [Gossypium hirsutum] Length = 250 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 4/42 (9%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ----PPT 547 RS++NPYPTTFVQADTTTFK VVQ+LTGSSET +Q PPT Sbjct: 57 RSETNPYPTTFVQADTTTFKQVVQMLTGSSETAKQASSKPPT 98 >XP_012458197.1 PREDICTED: VQ motif-containing protein 19 [Gossypium raimondii] XP_016742843.1 PREDICTED: VQ motif-containing protein 19-like [Gossypium hirsutum] KJB13276.1 hypothetical protein B456_002G069400 [Gossypium raimondii] KJB13277.1 hypothetical protein B456_002G069400 [Gossypium raimondii] KJB13278.1 hypothetical protein B456_002G069400 [Gossypium raimondii] Length = 250 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 4/42 (9%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ----PPT 547 RS++NPYPTTFVQADTTTFK VVQ+LTGSSET +Q PPT Sbjct: 57 RSETNPYPTTFVQADTTTFKQVVQMLTGSSETAKQASSKPPT 98 >XP_017639494.1 PREDICTED: VQ motif-containing protein 19-like [Gossypium arboreum] Length = 253 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 4/42 (9%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ----PPT 547 RS++NPYPTTFVQADTTTFK VVQ+LTGSSET +Q PPT Sbjct: 57 RSETNPYPTTFVQADTTTFKQVVQMLTGSSETAKQASSKPPT 98 >KHG22617.1 hypothetical protein F383_03340 [Gossypium arboreum] Length = 253 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 4/42 (9%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ----PPT 547 RS++NPYPTTFVQADTTTFK VVQ+LTGSSET +Q PPT Sbjct: 57 RSETNPYPTTFVQADTTTFKQVVQMLTGSSETAKQASSKPPT 98 >XP_018850672.1 PREDICTED: VQ motif-containing protein 4-like [Juglans regia] Length = 234 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQPP 544 RSDSNPYPTTFVQADT+TFK VVQ+LTGSSET + P Sbjct: 53 RSDSNPYPTTFVQADTSTFKQVVQMLTGSSETAKPSP 89 >OMO73275.1 VQ motif-containing protein [Corchorus olitorius] Length = 260 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 5/43 (11%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ-----PPT 547 RS++NPYPTTFVQADTTTFK VVQ+LTGSSET +Q PPT Sbjct: 58 RSETNPYPTTFVQADTTTFKQVVQMLTGSSETAKQASSPRPPT 100 >OMO55639.1 VQ motif-containing protein [Corchorus capsularis] Length = 265 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 5/43 (11%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ-----PPT 547 RS++NPYPTTFVQADTTTFK VVQ+LTGSSET +Q PPT Sbjct: 60 RSETNPYPTTFVQADTTTFKQVVQMLTGSSETAKQASSPRPPT 102 >XP_019425886.1 PREDICTED: VQ motif-containing protein 4-like [Lupinus angustifolius] OIV92401.1 hypothetical protein TanjilG_23001 [Lupinus angustifolius] Length = 221 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSET 529 RSDS+PYPTTFVQADT+TFKHVVQ+LTGSSET Sbjct: 35 RSDSSPYPTTFVQADTSTFKHVVQMLTGSSET 66 >ACU18161.1 unknown, partial [Glycine max] Length = 205 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ 538 RSDSNPYPTTFVQADT+TFK VVQ+LTGSS+T +Q Sbjct: 58 RSDSNPYPTTFVQADTSTFKQVVQMLTGSSDTTKQ 92 >GAV72309.1 VQ domain-containing protein [Cephalotus follicularis] Length = 243 Score = 63.9 bits (154), Expect = 4e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ 538 RSD+NPYPTTFVQADTTTFK VVQ+LTGS+ET +Q Sbjct: 46 RSDTNPYPTTFVQADTTTFKQVVQMLTGSTETAKQ 80 >XP_012441422.1 PREDICTED: VQ motif-containing protein 4-like [Gossypium raimondii] KJB61829.1 hypothetical protein B456_009G384400 [Gossypium raimondii] Length = 225 Score = 63.5 bits (153), Expect = 5e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ 538 RS++NPYPTTFVQADTTTFK VVQ+LTGSSET +Q Sbjct: 45 RSETNPYPTTFVQADTTTFKQVVQMLTGSSETAKQ 79 >XP_017612914.1 PREDICTED: VQ motif-containing protein 4-like [Gossypium arboreum] Length = 226 Score = 63.5 bits (153), Expect = 5e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 434 RSDSNPYPTTFVQADTTTFKHVVQLLTGSSETKQQ 538 RS++NPYPTTFVQADTTTFK VVQ+LTGSSET +Q Sbjct: 46 RSETNPYPTTFVQADTTTFKQVVQMLTGSSETAKQ 80