BLASTX nr result
ID: Glycyrrhiza30_contig00019066
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00019066 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004503273.1 PREDICTED: translocon at the outer membrane of ch... 56 2e-06 >XP_004503273.1 PREDICTED: translocon at the outer membrane of chloroplasts 64 isoform X2 [Cicer arietinum] XP_012572070.1 PREDICTED: translocon at the outer membrane of chloroplasts 64 isoform X1 [Cicer arietinum] Length = 592 Score = 56.2 bits (134), Expect = 2e-06 Identities = 35/76 (46%), Positives = 40/76 (52%) Frame = +1 Query: 103 LEADATCLGTTVIDDFTFRARYSTCFVPLLVSSFVGENLHQRLPTNLAVSA*VLGASCSG 282 +EA ATCLGTTV+D+F + GEN H PTN AV A V G S SG Sbjct: 104 VEAGATCLGTTVLDEFAY--------------GISGENKHFGAPTNPAVPARVPGGSSSG 149 Query: 283 TVLVGAYNFVDFSFEV 330 + A NFVDFS V Sbjct: 150 AAVSVAANFVDFSLGV 165