BLASTX nr result
ID: Glycyrrhiza30_contig00018958
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018958 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014519928.1 PREDICTED: ethylene-responsive transcription fact... 55 3e-07 XP_017407212.1 PREDICTED: ethylene-responsive transcription fact... 55 3e-07 XP_003538170.1 PREDICTED: ethylene-responsive transcription fact... 54 6e-07 XP_007158572.1 hypothetical protein PHAVU_002G163700g [Phaseolus... 54 1e-06 XP_003516719.1 PREDICTED: ethylene-responsive transcription fact... 53 2e-06 AFK37793.1 unknown [Medicago truncatula] 53 2e-06 XP_003611004.1 AP2 domain class transcription factor [Medicago t... 53 2e-06 APZ75914.1 DREB6.7 [Malus sieversii] 53 2e-06 XP_008341502.1 PREDICTED: ethylene-responsive transcription fact... 53 2e-06 OIV94935.1 hypothetical protein TanjilG_22132 [Lupinus angustifo... 52 3e-06 XP_019420967.1 PREDICTED: ethylene-responsive transcription fact... 52 3e-06 >XP_014519928.1 PREDICTED: ethylene-responsive transcription factor ERF061 [Vigna radiata var. radiata] Length = 329 Score = 55.1 bits (131), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 211 VTGETELFEGCSLARMPSFDPELIWEVLAV 122 VT ETE FEGCSLAR+PSFDPELIWEVLAV Sbjct: 301 VTDETE-FEGCSLARLPSFDPELIWEVLAV 329 >XP_017407212.1 PREDICTED: ethylene-responsive transcription factor ERF061 [Vigna angularis] KOM27138.1 hypothetical protein LR48_Vigan401s004800 [Vigna angularis] BAU00633.1 hypothetical protein VIGAN_10224400 [Vigna angularis var. angularis] Length = 329 Score = 55.1 bits (131), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 211 VTGETELFEGCSLARMPSFDPELIWEVLAV 122 VT ETE FEGCSLAR+PSFDPELIWEVLAV Sbjct: 301 VTDETE-FEGCSLARLPSFDPELIWEVLAV 329 >XP_003538170.1 PREDICTED: ethylene-responsive transcription factor ERF061-like [Glycine max] ALA09109.1 AP2-EREBP transcription factor, partial [Glycine max] KRH27850.1 hypothetical protein GLYMA_11G018100 [Glycine max] Length = 325 Score = 54.3 bits (129), Expect = 6e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 196 ELFEGCSLARMPSFDPELIWEVLAV 122 ELFEGCSLAR+PSFDPELIWEVLAV Sbjct: 301 ELFEGCSLARLPSFDPELIWEVLAV 325 >XP_007158572.1 hypothetical protein PHAVU_002G163700g [Phaseolus vulgaris] ESW30566.1 hypothetical protein PHAVU_002G163700g [Phaseolus vulgaris] Length = 322 Score = 53.5 bits (127), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 211 VTGETELFEGCSLARMPSFDPELIWEVLAV 122 VT +TE FEGCSLAR+PSFDPELIWEVLA+ Sbjct: 294 VTDDTE-FEGCSLARLPSFDPELIWEVLAI 322 >XP_003516719.1 PREDICTED: ethylene-responsive transcription factor ERF061-like [Glycine max] ALA09093.1 AP2-EREBP transcription factor, partial [Glycine max] KRH77640.1 hypothetical protein GLYMA_01G225000 [Glycine max] Length = 314 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = -3 Query: 208 TGETEL-FEGCSLARMPSFDPELIWEVLAV 122 T ETEL FEGCSLAR+PSFDPELIWEVL V Sbjct: 285 TEETELLFEGCSLARLPSFDPELIWEVLTV 314 >AFK37793.1 unknown [Medicago truncatula] Length = 320 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 211 VTGETELFEGCSLARMPSFDPELIWEVLAV 122 VT ETE FE CSLARMPSFDPELIWEVLAV Sbjct: 292 VTEETE-FEDCSLARMPSFDPELIWEVLAV 320 >XP_003611004.1 AP2 domain class transcription factor [Medicago truncatula] AES93962.1 AP2 domain class transcription factor [Medicago truncatula] Length = 320 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 211 VTGETELFEGCSLARMPSFDPELIWEVLAV 122 VT ETE FE CSLARMPSFDPELIWEVLAV Sbjct: 292 VTEETE-FEDCSLARMPSFDPELIWEVLAV 320 >APZ75914.1 DREB6.7 [Malus sieversii] Length = 325 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 205 GETELFEGCSLARMPSFDPELIWEVLAV 122 GE FEGCSLA+MPSFDPELIWEVLA+ Sbjct: 298 GEKSEFEGCSLAKMPSFDPELIWEVLAI 325 >XP_008341502.1 PREDICTED: ethylene-responsive transcription factor ERF061 [Malus domestica] Length = 325 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 205 GETELFEGCSLARMPSFDPELIWEVLAV 122 GE FEGCSLA+MPSFDPELIWEVLA+ Sbjct: 298 GEKSEFEGCSLAKMPSFDPELIWEVLAI 325 >OIV94935.1 hypothetical protein TanjilG_22132 [Lupinus angustifolius] Length = 344 Score = 52.4 bits (124), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 211 VTGETELFEGCSLARMPSFDPELIWEVLA 125 VT E E FEGCSLARMPSFDPELIWEVLA Sbjct: 316 VTDEPE-FEGCSLARMPSFDPELIWEVLA 343 >XP_019420967.1 PREDICTED: ethylene-responsive transcription factor ERF061-like isoform X1 [Lupinus angustifolius] Length = 405 Score = 52.4 bits (124), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 211 VTGETELFEGCSLARMPSFDPELIWEVLA 125 VT E E FEGCSLARMPSFDPELIWEVLA Sbjct: 377 VTDEPE-FEGCSLARMPSFDPELIWEVLA 404