BLASTX nr result
ID: Glycyrrhiza30_contig00018917
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018917 (445 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004492093.1 PREDICTED: zinc finger protein ZAT11-like [Cicer ... 58 1e-07 GAU17780.1 hypothetical protein TSUD_171690 [Trifolium subterran... 58 2e-07 XP_003621801.1 C2H2-type zinc finger protein [Medicago truncatul... 57 3e-07 KHN13875.1 Zinc finger protein ZAT11 [Glycine soja] 54 2e-06 KHN27209.1 Zinc finger protein ZAT11 [Glycine soja] 54 3e-06 XP_003552680.1 PREDICTED: zinc finger protein ZAT11-like [Glycin... 54 3e-06 KRH70509.1 hypothetical protein GLYMA_02G094500 [Glycine max] 54 3e-06 NP_001237020.1 uncharacterized protein LOC100500371 [Glycine max... 54 3e-06 >XP_004492093.1 PREDICTED: zinc finger protein ZAT11-like [Cicer arietinum] Length = 177 Score = 58.2 bits (139), Expect = 1e-07 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -1 Query: 349 MKGAGNRRSAALVLDLNLTPFENDLEFLKIGKATTANLVDYL 224 MK GN+R VLDLNLTPFENDLEF KIGK TT NLVDYL Sbjct: 138 MKVVGNKR--VFVLDLNLTPFENDLEFFKIGK-TTPNLVDYL 176 >GAU17780.1 hypothetical protein TSUD_171690 [Trifolium subterraneum] Length = 184 Score = 57.8 bits (138), Expect = 2e-07 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -1 Query: 349 MKGAGNRRSAALVLDLNLTPFENDLEFLKIGKATTANLVDYL 224 MKG N+R L LDLNLTPFENDLE LKIGK TTANL+DYL Sbjct: 144 MKGR-NKRVLVLNLDLNLTPFENDLEILKIGK-TTANLIDYL 183 >XP_003621801.1 C2H2-type zinc finger protein [Medicago truncatula] AES78019.1 C2H2-type zinc finger protein [Medicago truncatula] Length = 184 Score = 57.0 bits (136), Expect = 3e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 340 AGNRRSAALVLDLNLTPFENDLEFLKIGKATTANLVDY 227 A N+R L LDLNLTPFEND+EFLKIGKA TANL+DY Sbjct: 146 ARNKRVLVLDLDLNLTPFENDMEFLKIGKA-TANLIDY 182 >KHN13875.1 Zinc finger protein ZAT11 [Glycine soja] Length = 164 Score = 54.3 bits (129), Expect = 2e-06 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -1 Query: 346 KGAGNRRSAALVLDLNLTPFENDLEFLKIGKATTANLVDYL 224 K A N+R LVLDLNLTPFENDLEFLKIGK TT VDYL Sbjct: 127 KKADNKR--VLVLDLNLTPFENDLEFLKIGKPTT--FVDYL 163 >KHN27209.1 Zinc finger protein ZAT11 [Glycine soja] Length = 169 Score = 54.3 bits (129), Expect = 3e-06 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -1 Query: 346 KGAGNRRSAALVLDLNLTPFENDLEFLKIGKATTANLVDYL 224 K A N+R LVLDLNLTPFENDLEFLKIGK TT VDYL Sbjct: 132 KKADNKR--VLVLDLNLTPFENDLEFLKIGKPTT--FVDYL 168 >XP_003552680.1 PREDICTED: zinc finger protein ZAT11-like [Glycine max] KRH01600.1 hypothetical protein GLYMA_18G287200 [Glycine max] Length = 175 Score = 54.3 bits (129), Expect = 3e-06 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -1 Query: 346 KGAGNRRSAALVLDLNLTPFENDLEFLKIGKATTANLVDYL 224 K A N+R LVLDLNLTPFENDLEFLKIGK TT VDYL Sbjct: 138 KKADNKR--VLVLDLNLTPFENDLEFLKIGKPTT--FVDYL 174 >KRH70509.1 hypothetical protein GLYMA_02G094500 [Glycine max] Length = 180 Score = 54.3 bits (129), Expect = 3e-06 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -1 Query: 346 KGAGNRRSAALVLDLNLTPFENDLEFLKIGKATTANLVDYL 224 K A N+R LVLDLNLTPFENDLEFLKIGK TT VDYL Sbjct: 143 KKADNKR--VLVLDLNLTPFENDLEFLKIGKPTT--FVDYL 179 >NP_001237020.1 uncharacterized protein LOC100500371 [Glycine max] ACU15428.1 unknown [Glycine max] Length = 180 Score = 54.3 bits (129), Expect = 3e-06 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -1 Query: 346 KGAGNRRSAALVLDLNLTPFENDLEFLKIGKATTANLVDYL 224 K A N+R LVLDLNLTPFENDLEFLKIGK TT VDYL Sbjct: 143 KKADNKR--VLVLDLNLTPFENDLEFLKIGKPTT--FVDYL 179