BLASTX nr result
ID: Glycyrrhiza30_contig00018915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018915 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016474715.1 PREDICTED: probable carboxylesterase 15 [Nicotian... 90 1e-19 XP_009788938.1 PREDICTED: probable carboxylesterase 15 [Nicotian... 90 1e-19 AAF62404.1 cell death associated protein [Nicotiana tabacum] 90 1e-19 XP_019241733.1 PREDICTED: probable carboxylesterase 17 [Nicotian... 89 2e-19 XP_004307204.2 PREDICTED: probable carboxylesterase 15 [Fragaria... 89 2e-19 XP_019227602.1 PREDICTED: probable carboxylesterase 17 [Nicotian... 89 2e-19 XP_016472904.1 PREDICTED: probable carboxylesterase 15 [Nicotian... 88 4e-19 XP_016559361.1 PREDICTED: probable carboxylesterase 6 [Capsicum ... 87 9e-19 BAD11070.1 HSR203J like protein [Capsicum chinense] 87 9e-19 XP_012068726.1 PREDICTED: probable carboxylesterase 17 [Jatropha... 87 9e-19 GAU48392.1 hypothetical protein TSUD_118180 [Trifolium subterran... 87 9e-19 GAU48393.1 hypothetical protein TSUD_118190 [Trifolium subterran... 87 1e-18 XP_009798409.1 PREDICTED: probable carboxylesterase 15 [Nicotian... 86 3e-18 BAA85654.1 hsr203J homolog [Pisum sativum] 86 3e-18 GAU48394.1 hypothetical protein TSUD_118200 [Trifolium subterran... 86 3e-18 XP_013458944.1 CXE carboxylesterase [Medicago truncatula] KEH329... 86 3e-18 XP_017644949.1 PREDICTED: probable carboxylesterase 15 [Gossypiu... 86 4e-18 XP_016714670.1 PREDICTED: probable carboxylesterase 15 [Gossypiu... 86 5e-18 XP_006385976.1 hypothetical protein POPTR_0003s19190g [Populus t... 86 5e-18 XP_002304812.2 hsr203J family protein [Populus trichocarpa] EEE7... 86 5e-18 >XP_016474715.1 PREDICTED: probable carboxylesterase 15 [Nicotiana tabacum] Length = 335 Score = 89.7 bits (221), Expect = 1e-19 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V++E+SGWLRVF+DGSV+RTWTGPPEVKFM EP PPH+ FI Sbjct: 1 MVHEKQVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPVPPHDYFI 47 >XP_009788938.1 PREDICTED: probable carboxylesterase 15 [Nicotiana sylvestris] CAA54393.1 HSR203J [Nicotiana tabacum] Length = 335 Score = 89.7 bits (221), Expect = 1e-19 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V++E+SGWLRVF+DGSV+RTWTGPPEVKFM EP PPH+ FI Sbjct: 1 MVHEKQVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPVPPHDYFI 47 >AAF62404.1 cell death associated protein [Nicotiana tabacum] Length = 335 Score = 89.7 bits (221), Expect = 1e-19 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V++E+SGWLRVF+DGSV+RTWTGPPEVKFM EP PPH+ FI Sbjct: 1 MVHEKQVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPVPPHDYFI 47 >XP_019241733.1 PREDICTED: probable carboxylesterase 17 [Nicotiana attenuata] OIT19216.1 putative carboxylesterase 17 [Nicotiana attenuata] Length = 335 Score = 89.4 bits (220), Expect = 2e-19 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V++E+SGWLRVF DGSV+RTWTGPPEVKFM EP PPH+ FI Sbjct: 1 MVHEKQVIEEVSGWLRVFDDGSVDRTWTGPPEVKFMAEPVPPHDDFI 47 >XP_004307204.2 PREDICTED: probable carboxylesterase 15 [Fragaria vesca subsp. vesca] Length = 366 Score = 89.4 bits (220), Expect = 2e-19 Identities = 40/67 (59%), Positives = 52/67 (77%), Gaps = 8/67 (11%) Frame = -2 Query: 177 THISSVIL--------NSTTMVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPA 22 +HI S +L ++ TMV EKK+VDE+SGWLR++ DGSV+RTWTGPP+VKFM EP Sbjct: 10 SHIYSKVLISKPTIKRSNNTMVREKKLVDEVSGWLRLYNDGSVDRTWTGPPQVKFMAEPV 69 Query: 21 PPHEQFI 1 PPH++FI Sbjct: 70 PPHDEFI 76 >XP_019227602.1 PREDICTED: probable carboxylesterase 17 [Nicotiana attenuata] OIT06160.1 putative carboxylesterase 17 [Nicotiana attenuata] Length = 335 Score = 89.0 bits (219), Expect = 2e-19 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V++E+SGWLRVF+D SV+RTWTGPPEVKFM EP PPHE FI Sbjct: 1 MVHEKQVIEEVSGWLRVFEDSSVDRTWTGPPEVKFMAEPVPPHEDFI 47 >XP_016472904.1 PREDICTED: probable carboxylesterase 15 [Nicotiana tabacum] XP_018623985.1 PREDICTED: probable carboxylesterase 15 [Nicotiana tomentosiformis] Length = 336 Score = 88.2 bits (217), Expect = 4e-19 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V++E+SGWLRVF+DGSV+RTWTGPPEVKFM EP PPH+ +I Sbjct: 1 MVHEKQVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPFPPHDDYI 47 >XP_016559361.1 PREDICTED: probable carboxylesterase 6 [Capsicum annuum] Length = 335 Score = 87.4 bits (215), Expect = 9e-19 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V+DE+SGWLRVF DGSV+RTWTGPPEVKFM EP PH+ FI Sbjct: 1 MVHEKQVIDEVSGWLRVFDDGSVDRTWTGPPEVKFMSEPVKPHDDFI 47 >BAD11070.1 HSR203J like protein [Capsicum chinense] Length = 335 Score = 87.4 bits (215), Expect = 9e-19 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V+DE+SGWLRVF DGSV+RTWTGPPEVKFM EP PH+ FI Sbjct: 1 MVHEKQVIDEVSGWLRVFDDGSVDRTWTGPPEVKFMSEPVKPHDDFI 47 >XP_012068726.1 PREDICTED: probable carboxylesterase 17 [Jatropha curcas] KDP40570.1 hypothetical protein JCGZ_24569 [Jatropha curcas] Length = 336 Score = 87.4 bits (215), Expect = 9e-19 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHE+K+V+E+SGWLRV+ DGSV+RTWTGPP+VKFM EP P HEQFI Sbjct: 1 MVHERKIVEEVSGWLRVYDDGSVDRTWTGPPQVKFMAEPVPAHEQFI 47 >GAU48392.1 hypothetical protein TSUD_118180 [Trifolium subterraneum] Length = 338 Score = 87.4 bits (215), Expect = 9e-19 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MV EKK+VDE+SGWLR++ DGSV+RTWTGPPEV+FMIEP PHEQFI Sbjct: 1 MVQEKKLVDEVSGWLRIYDDGSVDRTWTGPPEVEFMIEPVAPHEQFI 47 >GAU48393.1 hypothetical protein TSUD_118190 [Trifolium subterraneum] Length = 340 Score = 87.0 bits (214), Expect = 1e-18 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MV EKK+VDE+SGWLR++ DGSV+RTWTGPPEVKFMIEP PHE FI Sbjct: 1 MVQEKKLVDEVSGWLRIYDDGSVDRTWTGPPEVKFMIEPVAPHEHFI 47 >XP_009798409.1 PREDICTED: probable carboxylesterase 15 [Nicotiana sylvestris] XP_016441243.1 PREDICTED: probable carboxylesterase 15 [Nicotiana tabacum] Length = 368 Score = 86.3 bits (212), Expect = 3e-18 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MVHEK+V++E+SGWLRVF+DGSV+RTWTGP EVKFM EP PPH+ FI Sbjct: 1 MVHEKQVIEEVSGWLRVFEDGSVDRTWTGPLEVKFMAEPVPPHDDFI 47 >BAA85654.1 hsr203J homolog [Pisum sativum] Length = 339 Score = 85.9 bits (211), Expect = 3e-18 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MV EKK+VDE+SGWLR++ DGSV+RTWTGPPEV FMIEP PHE+FI Sbjct: 1 MVQEKKLVDEVSGWLRIYDDGSVDRTWTGPPEVNFMIEPVAPHEEFI 47 >GAU48394.1 hypothetical protein TSUD_118200 [Trifolium subterraneum] Length = 340 Score = 85.9 bits (211), Expect = 3e-18 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 M+ EKK+VDE+SGWLR++ DGSV+RTWTGPPE KFMI+P PHEQFI Sbjct: 1 MIQEKKLVDEVSGWLRIYDDGSVDRTWTGPPEAKFMIDPVAPHEQFI 47 >XP_013458944.1 CXE carboxylesterase [Medicago truncatula] KEH32986.1 CXE carboxylesterase [Medicago truncatula] Length = 343 Score = 85.9 bits (211), Expect = 3e-18 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 MV +KK+VDE+SGWLR++ DGSV+RTWTGPPEV FMIEP PHEQFI Sbjct: 1 MVQQKKLVDEVSGWLRIYNDGSVDRTWTGPPEVTFMIEPVAPHEQFI 47 >XP_017644949.1 PREDICTED: probable carboxylesterase 15 [Gossypium arboreum] Length = 332 Score = 85.5 bits (210), Expect = 4e-18 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 M+ EKK+V+E+SGWLRV+ DGSV+RTWTGPPEVKFM EP PHEQFI Sbjct: 1 MIQEKKLVEEVSGWLRVYDDGSVDRTWTGPPEVKFMAEPVSPHEQFI 47 >XP_016714670.1 PREDICTED: probable carboxylesterase 15 [Gossypium hirsutum] Length = 336 Score = 85.5 bits (210), Expect = 5e-18 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQFI 1 M+ EKK+V+E+SGWLRV+ DGSV+RTWTGPPEVKFM EP PHEQFI Sbjct: 1 MIQEKKLVEEVSGWLRVYDDGSVDRTWTGPPEVKFMAEPVSPHEQFI 47 >XP_006385976.1 hypothetical protein POPTR_0003s19190g [Populus trichocarpa] ERP63773.1 hypothetical protein POPTR_0003s19190g [Populus trichocarpa] Length = 339 Score = 85.5 bits (210), Expect = 5e-18 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQF 4 MVH+KK+V+E+SGWLR F DGSV+RTWTGPPEV FM EP PPHE+F Sbjct: 1 MVHQKKLVEEVSGWLRTFDDGSVDRTWTGPPEVTFMAEPVPPHEEF 46 >XP_002304812.2 hsr203J family protein [Populus trichocarpa] EEE79791.2 hsr203J family protein [Populus trichocarpa] Length = 339 Score = 85.5 bits (210), Expect = 5e-18 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 141 MVHEKKVVDELSGWLRVFKDGSVERTWTGPPEVKFMIEPAPPHEQF 4 MVH+KK+V+E+SGWLR F DGSV+RTWTGPPEV FM EP PPHE+F Sbjct: 1 MVHQKKLVEEVSGWLRTFDDGSVDRTWTGPPEVTFMAEPVPPHEEF 46