BLASTX nr result
ID: Glycyrrhiza30_contig00018895
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018895 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015969366.1 PREDICTED: DUF21 domain-containing protein At4g14... 55 5e-06 >XP_015969366.1 PREDICTED: DUF21 domain-containing protein At4g14240 [Arachis duranensis] Length = 477 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -1 Query: 408 EIVDETDVYIDVHXXXXXXXXXXXXXXXXVPSGQKLTGHKPLGNQASK 265 EIVDETDVY+DVH VPSG+KLT HKP+GNQASK Sbjct: 430 EIVDETDVYVDVHRRIRVAAVAAATSVARVPSGRKLTVHKPVGNQASK 477