BLASTX nr result
ID: Glycyrrhiza30_contig00018747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018747 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK47311.1 unknown [Lotus japonicus] 60 9e-10 AFK38658.1 unknown [Lotus japonicus] 58 2e-09 AFK37277.1 unknown [Lotus japonicus] 57 8e-09 XP_004515154.1 PREDICTED: putative late blight resistance protei... 57 1e-08 KHN42457.1 hypothetical protein glysoja_033925 [Glycine soja] 57 1e-08 NP_001235140.1 uncharacterized protein LOC100306444 [Glycine max... 57 1e-08 KRH38366.1 hypothetical protein GLYMA_09G130900 [Glycine max] 55 3e-08 KHN42451.1 hypothetical protein glysoja_033919 [Glycine soja] 55 3e-08 XP_007152161.1 hypothetical protein PHAVU_004G106900g [Phaseolus... 55 8e-08 XP_014503341.1 PREDICTED: uncharacterized protein LOC106763688 [... 55 8e-08 XP_017437788.1 PREDICTED: uncharacterized protein LOC108343875 [... 55 8e-08 NP_001238249.1 uncharacterized protein LOC100527327 [Glycine max... 54 1e-07 KRH38360.1 hypothetical protein GLYMA_09G130400 [Glycine max] 54 2e-07 XP_019451570.1 PREDICTED: heavy metal-associated isoprenylated p... 54 2e-07 XP_006589521.2 PREDICTED: uncharacterized protein LOC100793876 [... 54 2e-07 XP_019450806.1 PREDICTED: heavy metal-associated isoprenylated p... 53 2e-07 BAO45868.1 hypothetical protein [Acacia mangium] 53 3e-07 GAU32348.1 hypothetical protein TSUD_43900 [Trifolium subterraneum] 53 4e-07 XP_019427333.1 PREDICTED: heavy metal-associated isoprenylated p... 53 5e-07 XP_014635044.1 PREDICTED: uncharacterized protein LOC100527327 i... 52 6e-07 >AFK47311.1 unknown [Lotus japonicus] Length = 131 Score = 59.7 bits (143), Expect = 9e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE Sbjct: 1 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 30 >AFK38658.1 unknown [Lotus japonicus] Length = 95 Score = 58.2 bits (139), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVELYDDKIKKK MKAVSGLSGVE Sbjct: 1 MKKVVLKVELYDDKIKKKTMKAVSGLSGVE 30 >AFK37277.1 unknown [Lotus japonicus] Length = 133 Score = 57.4 bits (137), Expect = 8e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVELYDDKIKKKAMKAV GLSGVE Sbjct: 1 MKKVVLKVELYDDKIKKKAMKAVFGLSGVE 30 >XP_004515154.1 PREDICTED: putative late blight resistance protein homolog R1B-19 [Cicer arietinum] Length = 132 Score = 57.0 bits (136), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 M K+VLKVELYDDKIKKKAMKAVSGLSGVE Sbjct: 1 MMKIVLKVELYDDKIKKKAMKAVSGLSGVE 30 >KHN42457.1 hypothetical protein glysoja_033925 [Glycine soja] Length = 136 Score = 57.0 bits (136), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVEL+DDKIKKKAMKAVSG+SGVE Sbjct: 1 MKKVVLKVELHDDKIKKKAMKAVSGISGVE 30 >NP_001235140.1 uncharacterized protein LOC100306444 [Glycine max] ACU14624.1 unknown [Glycine max] Length = 136 Score = 57.0 bits (136), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVEL+DDKIKKKAMKAVSG+SGVE Sbjct: 1 MKKVVLKVELHDDKIKKKAMKAVSGISGVE 30 >KRH38366.1 hypothetical protein GLYMA_09G130900 [Glycine max] Length = 113 Score = 55.5 bits (132), Expect = 3e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVEL+DDKIKKKAMKAVSG+SG E Sbjct: 1 MKKVVLKVELHDDKIKKKAMKAVSGISGAE 30 >KHN42451.1 hypothetical protein glysoja_033919 [Glycine soja] Length = 113 Score = 55.5 bits (132), Expect = 3e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVEL+DDKIKKKAMKAVSG+SG E Sbjct: 1 MKKVVLKVELHDDKIKKKAMKAVSGISGAE 30 >XP_007152161.1 hypothetical protein PHAVU_004G106900g [Phaseolus vulgaris] ESW24155.1 hypothetical protein PHAVU_004G106900g [Phaseolus vulgaris] Length = 128 Score = 54.7 bits (130), Expect = 8e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 M K+VLKVELYDDKIKKKAMK VSG+SGVE Sbjct: 1 MMKIVLKVELYDDKIKKKAMKTVSGISGVE 30 >XP_014503341.1 PREDICTED: uncharacterized protein LOC106763688 [Vigna radiata var. radiata] Length = 130 Score = 54.7 bits (130), Expect = 8e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 M KVVLKVELYDDKIKKKAMK VSG+SGVE Sbjct: 1 MMKVVLKVELYDDKIKKKAMKRVSGISGVE 30 >XP_017437788.1 PREDICTED: uncharacterized protein LOC108343875 [Vigna angularis] BAU02237.1 hypothetical protein VIGAN_11172000 [Vigna angularis var. angularis] Length = 132 Score = 54.7 bits (130), Expect = 8e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 M KVVLKVELYDDKIKKKAMK VSG+SGVE Sbjct: 1 MMKVVLKVELYDDKIKKKAMKRVSGISGVE 30 >NP_001238249.1 uncharacterized protein LOC100527327 [Glycine max] ACU16400.1 unknown [Glycine max] Length = 113 Score = 53.9 bits (128), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVEL+DDKIKKKA+KAVSG+SG E Sbjct: 1 MKKVVLKVELHDDKIKKKAVKAVSGISGAE 30 >KRH38360.1 hypothetical protein GLYMA_09G130400 [Glycine max] Length = 147 Score = 54.3 bits (129), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 ++KVVLKVEL+DDKIKKKAMKAVSG+SGVE Sbjct: 12 LEKVVLKVELHDDKIKKKAMKAVSGISGVE 41 >XP_019451570.1 PREDICTED: heavy metal-associated isoprenylated plant protein 39-like [Lupinus angustifolius] OIW06367.1 hypothetical protein TanjilG_15012 [Lupinus angustifolius] Length = 134 Score = 53.9 bits (128), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVELYDD+I+ KAMKAVSG+SGVE Sbjct: 1 MKKVVLKVELYDDRIQTKAMKAVSGISGVE 30 >XP_006589521.2 PREDICTED: uncharacterized protein LOC100793876 [Glycine max] Length = 138 Score = 53.9 bits (128), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKVVLKVE++DDKIKKKAMKAVSG+ GVE Sbjct: 1 MKKVVLKVEIHDDKIKKKAMKAVSGILGVE 30 >XP_019450806.1 PREDICTED: heavy metal-associated isoprenylated plant protein 39-like [Lupinus angustifolius] OIW08058.1 hypothetical protein TanjilG_20159 [Lupinus angustifolius] Length = 114 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKK++LKVEL+DDKI++KAMK+VSGLSGVE Sbjct: 1 MKKIILKVELHDDKIQRKAMKSVSGLSGVE 30 >BAO45868.1 hypothetical protein [Acacia mangium] Length = 120 Score = 53.1 bits (126), Expect = 3e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 M+K+VLKVEL+DDKIKKKAMKAVSG+ GVE Sbjct: 1 MQKIVLKVELHDDKIKKKAMKAVSGMPGVE 30 >GAU32348.1 hypothetical protein TSUD_43900 [Trifolium subterraneum] Length = 129 Score = 52.8 bits (125), Expect = 4e-07 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 MKKV+LK++++DDKIK+KAMKAVSGLSGVE Sbjct: 1 MKKVILKLDIHDDKIKQKAMKAVSGLSGVE 30 >XP_019427333.1 PREDICTED: heavy metal-associated isoprenylated plant protein 39-like [Lupinus angustifolius] Length = 135 Score = 52.8 bits (125), Expect = 5e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 91 MKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 M KVVLKVE+YDDKIKKKAMK VS LSGVE Sbjct: 1 MNKVVLKVEIYDDKIKKKAMKKVSSLSGVE 30 >XP_014635044.1 PREDICTED: uncharacterized protein LOC100527327 isoform X1 [Glycine max] Length = 127 Score = 52.4 bits (124), Expect = 6e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -3 Query: 133 LISQLSPLRKLP*QMKKVVLKVELYDDKIKKKAMKAVSGLSGVE 2 +I + P + +KVVLKVEL+DDKIKKKAMKAVSG+SG E Sbjct: 1 MIITIDPKSSIIFVRQKVVLKVELHDDKIKKKAMKAVSGISGAE 44