BLASTX nr result
ID: Glycyrrhiza30_contig00018668
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018668 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU13045.1 hypothetical protein TSUD_173450 [Trifolium subterran... 60 1e-08 XP_006426653.1 hypothetical protein CICLE_v10027046mg [Citrus cl... 58 6e-08 KDO38829.1 hypothetical protein CISIN_1g043817mg [Citrus sinensis] 58 6e-08 GAU38278.1 hypothetical protein TSUD_119590 [Trifolium subterran... 58 7e-08 XP_006441932.1 hypothetical protein CICLE_v10023487mg [Citrus cl... 57 1e-07 XP_003622277.1 cyclin-like F-box protein [Medicago truncatula] A... 56 3e-07 GAU13047.1 hypothetical protein TSUD_173470 [Trifolium subterran... 56 3e-07 XP_013448653.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 56 4e-07 XP_013448151.1 cyclin-like F-box protein [Medicago truncatula] K... 56 4e-07 XP_006472984.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340... 56 4e-07 XP_003591969.2 F-box-like protein [Medicago truncatula] AES62220... 54 5e-07 XP_003599614.1 F-box/RNI superfamily protein [Medicago truncatul... 52 5e-07 XP_013467007.1 cyclin-like F-box protein [Medicago truncatula] K... 55 6e-07 GAU30179.1 hypothetical protein TSUD_311300 [Trifolium subterran... 55 7e-07 GAU38249.1 hypothetical protein TSUD_119290 [Trifolium subterran... 55 1e-06 KDO39985.1 hypothetical protein CISIN_1g041388mg [Citrus sinensis] 54 2e-06 KDO43329.1 hypothetical protein CISIN_1g044387mg [Citrus sinensis] 54 2e-06 XP_006489754.1 PREDICTED: putative FBD-associated F-box protein ... 54 2e-06 EYU30515.1 hypothetical protein MIMGU_mgv1a009429mg [Erythranthe... 54 3e-06 XP_012845636.1 PREDICTED: F-box/LRR-repeat protein At3g26922-lik... 54 3e-06 >GAU13045.1 hypothetical protein TSUD_173450 [Trifolium subterraneum] Length = 343 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 170 SRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 SRRS PT DRISALPDSV+CHILSFLPTK +V T+ Sbjct: 3 SRRSIPTEDRISALPDSVICHILSFLPTKQSVTTT 37 >XP_006426653.1 hypothetical protein CICLE_v10027046mg [Citrus clementina] ESR39893.1 hypothetical protein CICLE_v10027046mg [Citrus clementina] Length = 324 Score = 58.2 bits (139), Expect = 6e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 170 SRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 S+ + ADRISALPDSVLCHILS++PTKHAVATS Sbjct: 17 SKTNRGNADRISALPDSVLCHILSYIPTKHAVATS 51 >KDO38829.1 hypothetical protein CISIN_1g043817mg [Citrus sinensis] Length = 337 Score = 58.2 bits (139), Expect = 6e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 170 SRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 S+ + ADRISALPDSVLCHILS++PTKHAVATS Sbjct: 17 SKTNRGNADRISALPDSVLCHILSYIPTKHAVATS 51 >GAU38278.1 hypothetical protein TSUD_119590 [Trifolium subterraneum] Length = 534 Score = 58.2 bits (139), Expect = 7e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 173 RRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 RRS PTADRIS LPDS+LCHILSFLPT +A TS Sbjct: 5 RRSIPTADRISDLPDSILCHILSFLPTNYAATTS 38 >XP_006441932.1 hypothetical protein CICLE_v10023487mg [Citrus clementina] ESR55172.1 hypothetical protein CICLE_v10023487mg [Citrus clementina] Length = 276 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +2 Query: 191 ADRISALPDSVLCHILSFLPTKHAVATS 274 ADRISALPDSVLCHILS++PTKHAVATS Sbjct: 24 ADRISALPDSVLCHILSYIPTKHAVATS 51 >XP_003622277.1 cyclin-like F-box protein [Medicago truncatula] AES78495.1 cyclin-like F-box protein [Medicago truncatula] Length = 356 Score = 56.2 bits (134), Expect = 3e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 170 SRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 S+ S PT DR+S LPDSV+CHILSFLPTK + ATS Sbjct: 3 SQHSIPTVDRVSVLPDSVICHILSFLPTKESAATS 37 >GAU13047.1 hypothetical protein TSUD_173470 [Trifolium subterraneum] Length = 387 Score = 56.2 bits (134), Expect = 3e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 179 SSPTADRISALPDSVLCHILSFLPTKHAVATS 274 SSPT DRIS LPDS++CHILSF PTK A ATS Sbjct: 2 SSPTVDRISTLPDSIICHILSFFPTKQAAATS 33 >XP_013448653.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH22680.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 293 Score = 55.8 bits (133), Expect = 4e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 176 RSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 RS+PT DRIS+LPD ++CHILSFLPTK++ ATS Sbjct: 3 RSNPTKDRISSLPDPIICHILSFLPTKNSAATS 35 >XP_013448151.1 cyclin-like F-box protein [Medicago truncatula] KEH22178.1 cyclin-like F-box protein [Medicago truncatula] Length = 419 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 170 SRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 S RS T DRISALPDSV+CHILSFLPTK + ATS Sbjct: 3 SPRSISTVDRISALPDSVICHILSFLPTKQSAATS 37 >XP_006472984.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340-like [Citrus sinensis] Length = 527 Score = 55.8 bits (133), Expect = 4e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 167 MSRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 M +++ ADRISALPDSVLCHILS+LPTK+ VATS Sbjct: 24 MQKQTEVKADRISALPDSVLCHILSYLPTKNVVATS 59 >XP_003591969.2 F-box-like protein [Medicago truncatula] AES62220.2 F-box-like protein [Medicago truncatula] Length = 143 Score = 53.9 bits (128), Expect = 5e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 173 RRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 RR+ PT DRIS LPDS+LCHILSF+PTK A TS Sbjct: 39 RRAIPTVDRISYLPDSILCHILSFVPTKLAAITS 72 >XP_003599614.1 F-box/RNI superfamily protein [Medicago truncatula] AES69865.1 F-box/RNI superfamily protein [Medicago truncatula] Length = 80 Score = 52.4 bits (124), Expect = 5e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 194 DRISALPDSVLCHILSFLPTKHAVATS 274 DRIS LP+SVLCHILSFLPTKHA ATS Sbjct: 52 DRISTLPNSVLCHILSFLPTKHAAATS 78 >XP_013467007.1 cyclin-like F-box protein [Medicago truncatula] KEH41042.1 cyclin-like F-box protein [Medicago truncatula] Length = 386 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 170 SRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 S RS PT DRISALPD+++CH LSFLPTK + ATS Sbjct: 3 SPRSIPTVDRISALPDNIICHTLSFLPTKQSAATS 37 >GAU30179.1 hypothetical protein TSUD_311300 [Trifolium subterraneum] Length = 238 Score = 54.7 bits (130), Expect = 7e-07 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +2 Query: 149 LTSPAEMSRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 ++S +RS PT DRIS LPDS+LCHILSFLPTK + TS Sbjct: 1 MSSSTLQPQRSIPTEDRISILPDSILCHILSFLPTKLSATTS 42 >GAU38249.1 hypothetical protein TSUD_119290 [Trifolium subterraneum] Length = 505 Score = 54.7 bits (130), Expect = 1e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +2 Query: 170 SRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 S RS PT DRIS LPD +LCHILSFLPTK A TS Sbjct: 4 SGRSIPTTDRISELPDPILCHILSFLPTKFAATTS 38 >KDO39985.1 hypothetical protein CISIN_1g041388mg [Citrus sinensis] Length = 440 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 191 ADRISALPDSVLCHILSFLPTKHAVATS 274 ADRIS+LPDSVLCHILS++PTKH VATS Sbjct: 24 ADRISSLPDSVLCHILSYIPTKHVVATS 51 >KDO43329.1 hypothetical protein CISIN_1g044387mg [Citrus sinensis] Length = 446 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 167 MSRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 M +++ AD ISALPDSVLCHILS+LPTK+AVATS Sbjct: 1 MQKQTEVKADWISALPDSVLCHILSYLPTKNAVATS 36 >XP_006489754.1 PREDICTED: putative FBD-associated F-box protein At3g50710 [Citrus sinensis] Length = 474 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 167 MSRRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 M +++ AD ISALPDSVLCHILS+LPTK+AVATS Sbjct: 15 MQKQTEVKADWISALPDSVLCHILSYLPTKNAVATS 50 >EYU30515.1 hypothetical protein MIMGU_mgv1a009429mg [Erythranthe guttata] Length = 342 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 173 RRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 R+SS DRIS LPDS+LCHILSFLPTK +VAT+ Sbjct: 13 RKSSSRIDRISDLPDSILCHILSFLPTKSSVATA 46 >XP_012845636.1 PREDICTED: F-box/LRR-repeat protein At3g26922-like [Erythranthe guttata] Length = 437 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 173 RRSSPTADRISALPDSVLCHILSFLPTKHAVATS 274 R+SS DRIS LPDS+LCHILSFLPTK +VAT+ Sbjct: 13 RKSSSRIDRISDLPDSILCHILSFLPTKSSVATA 46