BLASTX nr result
ID: Glycyrrhiza30_contig00018509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018509 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004494167.1 PREDICTED: protein YIPF5 homolog [Cicer arietinum] 66 9e-11 GAU16070.1 hypothetical protein TSUD_339410 [Trifolium subterran... 65 3e-10 XP_014495351.1 PREDICTED: protein YIPF5 homolog [Vigna radiata v... 64 1e-09 KYP71113.1 Protein YIPF7 [Cajanus cajan] 63 2e-09 BAT85853.1 hypothetical protein VIGAN_04344800 [Vigna angularis ... 62 3e-09 XP_017416093.1 PREDICTED: protein YIPF5 homolog [Vigna angularis... 62 4e-09 XP_019457059.1 PREDICTED: protein YIPF5 homolog [Lupinus angusti... 61 7e-09 XP_007162889.1 hypothetical protein PHAVU_001G189100g [Phaseolus... 61 9e-09 AGV54204.1 protein YIPF5-like protein [Phaseolus vulgaris] 61 9e-09 XP_003554430.1 PREDICTED: protein YIPF5 homolog [Glycine max] KR... 61 9e-09 XP_003521457.1 PREDICTED: protein YIPF5 homolog [Glycine max] KR... 61 9e-09 XP_003625805.1 integral membrane Yip1-family protein [Medicago t... 60 1e-08 AGV54718.1 YIPF5-like protein [Phaseolus vulgaris] 60 1e-08 XP_016196528.1 PREDICTED: protein YIPF5 homolog [Arachis ipaensis] 60 2e-08 XP_015939707.1 PREDICTED: protein YIPF5 homolog [Arachis duranen... 60 2e-08 XP_019444255.1 PREDICTED: protein YIPF5 homolog [Lupinus angusti... 59 7e-08 XP_016189548.1 PREDICTED: protein YIPF5 homolog [Arachis ipaensis] 58 9e-08 XP_018811171.1 PREDICTED: protein YIPF5 homolog [Juglans regia] 56 5e-07 XP_015955593.1 PREDICTED: protein YIPF5 homolog [Arachis duranen... 56 6e-07 JAU09299.1 Protein YIPF7 [Noccaea caerulescens] 55 1e-06 >XP_004494167.1 PREDICTED: protein YIPF5 homolog [Cicer arietinum] Length = 246 Score = 66.2 bits (160), Expect = 9e-11 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 245 PIYAGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 PIY+GP IGGGS +F+DEEP+LDELGIHPDQIW Sbjct: 59 PIYSGPGIGGGSANFDDEEPLLDELGIHPDQIW 91 >GAU16070.1 hypothetical protein TSUD_339410 [Trifolium subterraneum] Length = 246 Score = 64.7 bits (156), Expect = 3e-10 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 245 PIYAGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 PIY+GP IGGGS +F+DEEP+LDELGIHP+QIW Sbjct: 59 PIYSGPGIGGGSANFDDEEPLLDELGIHPEQIW 91 >XP_014495351.1 PREDICTED: protein YIPF5 homolog [Vigna radiata var. radiata] Length = 248 Score = 63.5 bits (153), Expect = 1e-09 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +2 Query: 227 SANENPPIYAGPDIGGG-SGSFNDEEPILDELGIHPDQIW 343 ++ + PIYAGP IGGG S +F+DEEP+LDELGIHPDQIW Sbjct: 54 ASTSSGPIYAGPSIGGGGSANFDDEEPLLDELGIHPDQIW 93 >KYP71113.1 Protein YIPF7 [Cajanus cajan] Length = 247 Score = 62.8 bits (151), Expect = 2e-09 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = +2 Query: 227 SANENPPIYAGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY+GP +GGG +F+DEEP+LDELGIHP+QIW Sbjct: 54 ASTSSGPIYSGPAVGGGGANFDDEEPLLDELGIHPEQIW 92 >BAT85853.1 hypothetical protein VIGAN_04344800 [Vigna angularis var. angularis] Length = 246 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/40 (67%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +2 Query: 227 SANENPPIYAGPDIGGG-SGSFNDEEPILDELGIHPDQIW 343 ++ + PIY GP IGGG S +F+DEEP+LDELGIHPDQIW Sbjct: 54 ASTSSGPIYTGPSIGGGGSANFDDEEPLLDELGIHPDQIW 93 >XP_017416093.1 PREDICTED: protein YIPF5 homolog [Vigna angularis] KOM39035.1 hypothetical protein LR48_Vigan03g241700 [Vigna angularis] Length = 248 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/40 (67%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +2 Query: 227 SANENPPIYAGPDIGGG-SGSFNDEEPILDELGIHPDQIW 343 ++ + PIY GP IGGG S +F+DEEP+LDELGIHPDQIW Sbjct: 54 ASTSSGPIYTGPSIGGGGSANFDDEEPLLDELGIHPDQIW 93 >XP_019457059.1 PREDICTED: protein YIPF5 homolog [Lupinus angustifolius] OIW05105.1 hypothetical protein TanjilG_02578 [Lupinus angustifolius] Length = 245 Score = 61.2 bits (147), Expect = 7e-09 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 227 SANENPPIYAGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY GP +GGGS +F DEEP+LDELGIHPDQIW Sbjct: 53 ASTSSGPIYTGP-VGGGSANFEDEEPLLDELGIHPDQIW 90 >XP_007162889.1 hypothetical protein PHAVU_001G189100g [Phaseolus vulgaris] ESW34883.1 hypothetical protein PHAVU_001G189100g [Phaseolus vulgaris] Length = 248 Score = 60.8 bits (146), Expect = 9e-09 Identities = 26/40 (65%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +2 Query: 227 SANENPPIYAGPDIGGG-SGSFNDEEPILDELGIHPDQIW 343 ++ + PIY GP +GGG S +F+DEEP+LDELGIHPDQIW Sbjct: 54 TSTSSGPIYTGPSMGGGGSANFDDEEPLLDELGIHPDQIW 93 >AGV54204.1 protein YIPF5-like protein [Phaseolus vulgaris] Length = 248 Score = 60.8 bits (146), Expect = 9e-09 Identities = 26/40 (65%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +2 Query: 227 SANENPPIYAGPDIGGG-SGSFNDEEPILDELGIHPDQIW 343 ++ + PIY GP +GGG S +F+DEEP+LDELGIHPDQIW Sbjct: 54 TSTSSGPIYTGPSMGGGGSANFDDEEPLLDELGIHPDQIW 93 >XP_003554430.1 PREDICTED: protein YIPF5 homolog [Glycine max] KRG96188.1 hypothetical protein GLYMA_19G194200 [Glycine max] Length = 248 Score = 60.8 bits (146), Expect = 9e-09 Identities = 26/40 (65%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +2 Query: 227 SANENPPIYAGPDIG-GGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY GP +G GGS +F+DEEP+LDELGIHPDQIW Sbjct: 54 ASTSSGPIYTGPAVGAGGSANFDDEEPLLDELGIHPDQIW 93 >XP_003521457.1 PREDICTED: protein YIPF5 homolog [Glycine max] KRH67901.1 hypothetical protein GLYMA_03G194400 [Glycine max] Length = 248 Score = 60.8 bits (146), Expect = 9e-09 Identities = 26/40 (65%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +2 Query: 227 SANENPPIYAGPDIG-GGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY GP +G GGS +F+DEEP+LDELGIHPDQIW Sbjct: 54 ASTSSGPIYTGPAVGPGGSANFDDEEPLLDELGIHPDQIW 93 >XP_003625805.1 integral membrane Yip1-family protein [Medicago truncatula] AES82023.1 integral membrane Yip1-family protein [Medicago truncatula] AFK37450.1 unknown [Medicago truncatula] Length = 245 Score = 60.5 bits (145), Expect = 1e-08 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +2 Query: 245 PIYAGPDIGGG-SGSFNDEEPILDELGIHPDQIW 343 PIY+GP IGGG S +F+DEEP+LDELGIHPDQIW Sbjct: 57 PIYSGPGIGGGGSVNFDDEEPLLDELGIHPDQIW 90 >AGV54718.1 YIPF5-like protein [Phaseolus vulgaris] Length = 249 Score = 60.5 bits (145), Expect = 1e-08 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +2 Query: 245 PIYAGPDIGGG-SGSFNDEEPILDELGIHPDQIW 343 PIY GP +GGG S +F+DEEP+LDELGIHPDQIW Sbjct: 60 PIYTGPSMGGGGSANFDDEEPLLDELGIHPDQIW 93 >XP_016196528.1 PREDICTED: protein YIPF5 homolog [Arachis ipaensis] Length = 246 Score = 59.7 bits (143), Expect = 2e-08 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +2 Query: 227 SANENPPIYAGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY+GP GGS +F+DEEP+LDELGIHP+QIW Sbjct: 53 ASTSSGPIYSGPGTVGGSANFDDEEPLLDELGIHPEQIW 91 >XP_015939707.1 PREDICTED: protein YIPF5 homolog [Arachis duranensis] Length = 246 Score = 59.7 bits (143), Expect = 2e-08 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +2 Query: 227 SANENPPIYAGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY+GP GGS +F+DEEP+LDELGIHP+QIW Sbjct: 53 ASTSSGPIYSGPGTVGGSANFDDEEPLLDELGIHPEQIW 91 >XP_019444255.1 PREDICTED: protein YIPF5 homolog [Lupinus angustifolius] OIW11351.1 hypothetical protein TanjilG_19607 [Lupinus angustifolius] Length = 245 Score = 58.5 bits (140), Expect = 7e-08 Identities = 26/41 (63%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = +2 Query: 227 SANENPPIYAGP--DIGGGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY GP GGGS +F DEEP+LDELGIHPDQIW Sbjct: 50 ASTSSGPIYTGPIGGSGGGSANFEDEEPLLDELGIHPDQIW 90 >XP_016189548.1 PREDICTED: protein YIPF5 homolog [Arachis ipaensis] Length = 246 Score = 58.2 bits (139), Expect = 9e-08 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = +2 Query: 227 SANENPPIYAGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY+GP GGS +F+DEEP+L+ELGIHP+QIW Sbjct: 53 ASTSSGPIYSGPGTVGGSANFDDEEPLLEELGIHPEQIW 91 >XP_018811171.1 PREDICTED: protein YIPF5 homolog [Juglans regia] Length = 254 Score = 56.2 bits (134), Expect = 5e-07 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 4/49 (8%) Frame = +2 Query: 209 TSPPTLSANENPPIYAGPDIGG----GSGSFNDEEPILDELGIHPDQIW 343 TS P+ S IY GP +GG G SF DEEP+LDELGIHPDQIW Sbjct: 57 TSTPSAS------IYGGPIVGGVGAPGGASFEDEEPLLDELGIHPDQIW 99 >XP_015955593.1 PREDICTED: protein YIPF5 homolog [Arachis duranensis] Length = 246 Score = 55.8 bits (133), Expect = 6e-07 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = +2 Query: 227 SANENPPIYAGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 ++ + PIY+ P GGS +F+DEEP+L+ELGIHP+QIW Sbjct: 53 ASTSSGPIYSAPGTVGGSANFDDEEPLLEELGIHPEQIW 91 >JAU09299.1 Protein YIPF7 [Noccaea caerulescens] Length = 248 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 254 AGPDIGGGSGSFNDEEPILDELGIHPDQIW 343 AGP GG S SF DEEP+LDELGIHPDQIW Sbjct: 63 AGPFGGGSSASFEDEEPLLDELGIHPDQIW 92