BLASTX nr result
ID: Glycyrrhiza30_contig00018382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018382 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK41343.1 unknown [Medicago truncatula] 59 7e-09 XP_019436316.1 PREDICTED: splicing factor U2af small subunit B-l... 56 4e-07 XP_019412971.1 PREDICTED: splicing factor U2af small subunit B-l... 53 5e-06 XP_016187541.1 PREDICTED: splicing factor U2af small subunit B-l... 53 5e-06 XP_015951731.1 PREDICTED: splicing factor U2af small subunit B-l... 53 5e-06 GAU35018.1 hypothetical protein TSUD_103410 [Trifolium subterran... 52 9e-06 >AFK41343.1 unknown [Medicago truncatula] Length = 125 Score = 58.5 bits (140), Expect = 7e-09 Identities = 38/80 (47%), Positives = 49/80 (61%), Gaps = 7/80 (8%) Frame = +1 Query: 1 VQVLEEGGVAVQPQMAVKRDVLELSNGTGRRKSKCIQIKLTLRK----TMATCKM---VM 159 V+VL EGG+ VQ M +RDV ELS+GTGR K + +Q++L RK T KM +M Sbjct: 34 VEVLLEGGIVVQSGMVARRDVRELSSGTGRGKRRNLQVRLIQRKPAMAITGTHKMLAHIM 93 Query: 160 SISSKSNNLGREDMDTDLCM 219 ISS N LGR D+D L + Sbjct: 94 RISSNGNLLGR-DIDLSLLL 112 >XP_019436316.1 PREDICTED: splicing factor U2af small subunit B-like [Lupinus angustifolius] XP_019436317.1 PREDICTED: splicing factor U2af small subunit B-like [Lupinus angustifolius] XP_019436319.1 PREDICTED: splicing factor U2af small subunit B-like [Lupinus angustifolius] XP_019436320.1 PREDICTED: splicing factor U2af small subunit B-like [Lupinus angustifolius] OIW15802.1 hypothetical protein TanjilG_04337 [Lupinus angustifolius] Length = 313 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +3 Query: 42 DGSEERRARIEQWNREKEEQVHSNKVDTEK-NNGY 143 +GSEERRARIEQWNRE+EE+ H +KVDTE+ NNG+ Sbjct: 259 EGSEERRARIEQWNREREEREHVSKVDTEETNNGH 293 >XP_019412971.1 PREDICTED: splicing factor U2af small subunit B-like [Lupinus angustifolius] XP_019412972.1 PREDICTED: splicing factor U2af small subunit B-like [Lupinus angustifolius] XP_019412973.1 PREDICTED: splicing factor U2af small subunit B-like [Lupinus angustifolius] XP_019412974.1 PREDICTED: splicing factor U2af small subunit B-like [Lupinus angustifolius] OIV99291.1 hypothetical protein TanjilG_17101 [Lupinus angustifolius] Length = 314 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = +3 Query: 42 DGSEERRARIEQWNREKEEQVHSNKVDTEK----NNGYM 146 D SEERRARIEQWNRE+EEQ + +KV+TE+ N+GYM Sbjct: 261 DPSEERRARIEQWNREREEQENPSKVNTERVDHGNDGYM 299 >XP_016187541.1 PREDICTED: splicing factor U2af small subunit B-like [Arachis ipaensis] XP_016187542.1 PREDICTED: splicing factor U2af small subunit B-like [Arachis ipaensis] XP_016187543.1 PREDICTED: splicing factor U2af small subunit B-like [Arachis ipaensis] Length = 319 Score = 53.1 bits (126), Expect = 5e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 42 DGSEERRARIEQWNREKEEQVHSNKVDTEKNNG 140 D SEERRARIEQWNREKE++ + KV++E+NNG Sbjct: 263 DSSEERRARIEQWNREKEQKENPRKVNSEENNG 295 >XP_015951731.1 PREDICTED: splicing factor U2af small subunit B-like [Arachis duranensis] XP_015951732.1 PREDICTED: splicing factor U2af small subunit B-like [Arachis duranensis] XP_015951733.1 PREDICTED: splicing factor U2af small subunit B-like [Arachis duranensis] Length = 321 Score = 53.1 bits (126), Expect = 5e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 42 DGSEERRARIEQWNREKEEQVHSNKVDTEKNNG 140 D SEERRARIEQWNREKE++ + KV++E+NNG Sbjct: 265 DSSEERRARIEQWNREKEQKENPRKVNSEENNG 297 >GAU35018.1 hypothetical protein TSUD_103410 [Trifolium subterraneum] Length = 325 Score = 52.4 bits (124), Expect = 9e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +3 Query: 42 DGSEERRARIEQWNREKEEQVHSNKVDTEKNN 137 DGSEERRARIEQWNRE+EE+ ++KV+TE+ N Sbjct: 266 DGSEERRARIEQWNREREEKEPASKVNTEETN 297