BLASTX nr result
ID: Glycyrrhiza30_contig00018087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00018087 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT74914.1 hypothetical protein VIGAN_01269200, partial [Vigna a... 61 2e-10 >BAT74914.1 hypothetical protein VIGAN_01269200, partial [Vigna angularis var. angularis] Length = 69 Score = 61.2 bits (147), Expect = 2e-10 Identities = 31/68 (45%), Positives = 41/68 (60%) Frame = -3 Query: 299 CNGVWRRICGEKDVGRNGRGNLAKEDQSHKSKEPHPQSTKSVL*SHEIYVKGLNSGAPRR 120 CNGVWRRICGEK+ + N + +S ++P ++++ YVKGL AP R Sbjct: 4 CNGVWRRICGEKEWEGRKKENGKERPKSEIQEQPTKHKIRTMMPC--FYVKGLKGKAPCR 61 Query: 119 EPTGFSEP 96 EPTGFSEP Sbjct: 62 EPTGFSEP 69