BLASTX nr result
ID: Glycyrrhiza30_contig00017416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00017416 (377 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_076831754.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-... 60 1e-09 ERF81030.1 hypothetical protein C207_05805 [Bradyrhizobium sp. D... 63 1e-09 >WP_076831754.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-321] OMI02987.1 hypothetical protein BSN85_28625 [Bradyrhizobium sp. UFLA 03-321] Length = 79 Score = 60.5 bits (145), Expect = 1e-09 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +1 Query: 229 GYTCGPTSRV-FYCAGPMGAIGTRLSLRPLRDEGGLKSKARTTHVAR 366 GYTCGPT + +C+GPMGAIGTR SLRP +EG SKART VAR Sbjct: 28 GYTCGPTPELPTHCSGPMGAIGTRSSLRPPIEEGETNSKARTIIVAR 74 >ERF81030.1 hypothetical protein C207_05805 [Bradyrhizobium sp. DFCI-1] Length = 217 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 373 FAFSRHESSELCSSNRPHLEEGAGKAGCRSHPWVP 269 FA SRH+ SELC+S RP L EGAGKAGCRSHPW P Sbjct: 180 FAISRHDRSELCASFRPPLTEGAGKAGCRSHPWAP 214