BLASTX nr result
ID: Glycyrrhiza30_contig00016955
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016955 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF50080.1 conserved hypothetical protein [Ricinus communis] 54 9e-07 >EEF50080.1 conserved hypothetical protein [Ricinus communis] Length = 223 Score = 54.3 bits (129), Expect = 9e-07 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +3 Query: 3 DSKIAXXXXXXXXXXXXEFGVIIDDCRRLLALSATFGVGFVRRLANVIAHSLAM 164 DSKIA EFG+IID+CR LL+L F V FV+R AN++AH LAM Sbjct: 140 DSKIAVDAIRSLAADWSEFGIIIDECRSLLSLGLNFQVYFVKRQANMVAHVLAM 193