BLASTX nr result
ID: Glycyrrhiza30_contig00016940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016940 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP56636.1 Pentatricopeptide repeat-containing protein At1g11290... 85 7e-17 GAU16443.1 hypothetical protein TSUD_117920 [Trifolium subterran... 82 1e-16 XP_007148793.1 hypothetical protein PHAVU_005G014800g [Phaseolus... 84 2e-16 XP_014499599.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 2e-16 XP_004499782.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 2e-16 XP_016180325.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 4e-16 XP_015946888.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 4e-16 KHN26409.1 Pentatricopeptide repeat-containing protein [Glycine ... 83 4e-16 XP_003526349.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 4e-16 KRH62733.1 hypothetical protein GLYMA_04G127500 [Glycine max] 82 6e-16 XP_003523921.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 6e-16 KHN10657.1 Pentatricopeptide repeat-containing protein [Glycine ... 82 6e-16 XP_014499600.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 8e-16 XP_017423185.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 8e-16 XP_007148792.1 hypothetical protein PHAVU_005G014700g [Phaseolus... 82 8e-16 GAU16444.1 hypothetical protein TSUD_117930 [Trifolium subterran... 82 1e-15 XP_013458907.1 pentatricopeptide (PPR) repeat protein [Medicago ... 82 1e-15 KCW65849.1 hypothetical protein EUGRSUZ_G03194 [Eucalyptus grandis] 80 3e-15 GAU16442.1 hypothetical protein TSUD_117910 [Trifolium subterran... 80 3e-15 JAU87251.1 Pentatricopeptide repeat-containing protein [Noccaea ... 80 3e-15 >KYP56636.1 Pentatricopeptide repeat-containing protein At1g11290 family [Cajanus cajan] Length = 704 Score = 85.1 bits (209), Expect = 7e-17 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW Sbjct: 668 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 704 >GAU16443.1 hypothetical protein TSUD_117920 [Trifolium subterraneum] Length = 215 Score = 81.6 bits (200), Expect = 1e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDL+RFHHFKNG CSCGDYW Sbjct: 179 HEATKYISLVTGREIIVRDLQRFHHFKNGRCSCGDYW 215 >XP_007148793.1 hypothetical protein PHAVU_005G014800g [Phaseolus vulgaris] ESW20787.1 hypothetical protein PHAVU_005G014800g [Phaseolus vulgaris] Length = 807 Score = 84.0 bits (206), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDLRRFHHFKNG+CSCGDYW Sbjct: 771 HEATKYISLVTGREIIVRDLRRFHHFKNGNCSCGDYW 807 >XP_014499599.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Vigna radiata var. radiata] Length = 818 Score = 84.0 bits (206), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDLRRFHHFKNG+CSCGDYW Sbjct: 782 HEATKYISLVTGREIIVRDLRRFHHFKNGNCSCGDYW 818 >XP_004499782.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290 [Cicer arietinum] Length = 814 Score = 83.6 bits (205), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDL+RFHHFKNGSCSCGDYW Sbjct: 778 HEATKYISLVTGREIIVRDLQRFHHFKNGSCSCGDYW 814 >XP_016180325.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Arachis ipaensis] Length = 813 Score = 82.8 bits (203), Expect = 4e-16 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREI+VRD+RRFHHFKNG+CSCGDYW Sbjct: 777 HEATKYISLVTGREIVVRDMRRFHHFKNGTCSCGDYW 813 >XP_015946888.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Arachis duranensis] Length = 813 Score = 82.8 bits (203), Expect = 4e-16 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREI+VRD+RRFHHFKNG+CSCGDYW Sbjct: 777 HEATKYISLVTGREIVVRDMRRFHHFKNGTCSCGDYW 813 >KHN26409.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 816 Score = 82.8 bits (203), Expect = 4e-16 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDLRRFHHFKNG CSCGDYW Sbjct: 780 HEATKYISLVTGREIIVRDLRRFHHFKNGICSCGDYW 816 >XP_003526349.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Glycine max] KRH56227.1 hypothetical protein GLYMA_06G311600 [Glycine max] Length = 816 Score = 82.8 bits (203), Expect = 4e-16 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDLRRFHHFKNG CSCGDYW Sbjct: 780 HEATKYISLVTGREIIVRDLRRFHHFKNGICSCGDYW 816 >KRH62733.1 hypothetical protein GLYMA_04G127500 [Glycine max] Length = 816 Score = 82.4 bits (202), Expect = 6e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 H+ TKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW Sbjct: 780 HDTTKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 816 >XP_003523921.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Glycine max] Length = 818 Score = 82.4 bits (202), Expect = 6e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 H+ TKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW Sbjct: 782 HDTTKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 818 >KHN10657.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 846 Score = 82.4 bits (202), Expect = 6e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 H+ TKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW Sbjct: 810 HDTTKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 846 >XP_014499600.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Vigna radiata var. radiata] Length = 814 Score = 82.0 bits (201), Expect = 8e-16 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSC DYW Sbjct: 778 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCKDYW 814 >XP_017423185.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Vigna angularis] KOM43064.1 hypothetical protein LR48_Vigan05g066800 [Vigna angularis] Length = 814 Score = 82.0 bits (201), Expect = 8e-16 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSC DYW Sbjct: 778 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCKDYW 814 >XP_007148792.1 hypothetical protein PHAVU_005G014700g [Phaseolus vulgaris] ESW20786.1 hypothetical protein PHAVU_005G014700g [Phaseolus vulgaris] Length = 814 Score = 82.0 bits (201), Expect = 8e-16 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSC DYW Sbjct: 778 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCRDYW 814 >GAU16444.1 hypothetical protein TSUD_117930 [Trifolium subterraneum] Length = 685 Score = 81.6 bits (200), Expect = 1e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDL+RFHHFKNG CSCGDYW Sbjct: 649 HEATKYISLVTGREIIVRDLQRFHHFKNGRCSCGDYW 685 >XP_013458907.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH32949.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 810 Score = 81.6 bits (200), Expect = 1e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 HEATKYISLVTGREIIVRDL+RFHHFKNG CSCGDYW Sbjct: 774 HEATKYISLVTGREIIVRDLQRFHHFKNGRCSCGDYW 810 >KCW65849.1 hypothetical protein EUGRSUZ_G03194 [Eucalyptus grandis] Length = 760 Score = 80.5 bits (197), Expect = 3e-15 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 H+ATKYISLVTGREIIVRD++RFHHFKNG+CSCGDYW Sbjct: 724 HDATKYISLVTGREIIVRDMQRFHHFKNGTCSCGDYW 760 >GAU16442.1 hypothetical protein TSUD_117910 [Trifolium subterraneum] Length = 789 Score = 80.5 bits (197), Expect = 3e-15 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 H+ATKY+SLVTGREIIVRDLRRFHHFKNG CSCGDYW Sbjct: 753 HDATKYMSLVTGREIIVRDLRRFHHFKNGICSCGDYW 789 >JAU87251.1 Pentatricopeptide repeat-containing protein [Noccaea caerulescens] Length = 811 Score = 80.5 bits (197), Expect = 3e-15 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -2 Query: 357 HEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 247 H+ATKYISLVTGREIIVRD++RFHHFKNG+CSCGDYW Sbjct: 775 HDATKYISLVTGREIIVRDMQRFHHFKNGACSCGDYW 811