BLASTX nr result
ID: Glycyrrhiza30_contig00016743
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016743 (228 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004508818.1 PREDICTED: serine/Arginine-related protein 53 [Ci... 67 3e-11 XP_003608933.1 arginine/serine-rich coiled coil protein [Medicag... 54 8e-07 GAU38369.1 hypothetical protein TSUD_209480 [Trifolium subterran... 52 4e-06 XP_019463495.1 PREDICTED: probable ATP-dependent RNA helicase DD... 52 5e-06 OIW00349.1 hypothetical protein TanjilG_27600 [Lupinus angustifo... 52 6e-06 >XP_004508818.1 PREDICTED: serine/Arginine-related protein 53 [Cicer arietinum] Length = 341 Score = 66.6 bits (161), Expect = 3e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 64 SDPPEPDKKAQLQSIQDKLRKKPTSESRVSEKTNCG 171 +DPPEPDKKAQLQSIQ+KL+KKPT+ESRVSEKTN G Sbjct: 62 TDPPEPDKKAQLQSIQNKLKKKPTTESRVSEKTNHG 97 >XP_003608933.1 arginine/serine-rich coiled coil protein [Medicago truncatula] AES91130.1 arginine/serine-rich coiled coil protein [Medicago truncatula] Length = 370 Score = 54.3 bits (129), Expect = 8e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 70 PPEPDKKAQLQSIQDKLRKKPTSESRVSEKTNCGY 174 P + D+K+QLQSIQ+KL+KKPT+ESRVSEKTN Y Sbjct: 72 PSDSDRKSQLQSIQNKLKKKPTTESRVSEKTNRDY 106 >GAU38369.1 hypothetical protein TSUD_209480 [Trifolium subterraneum] Length = 292 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 58 TYSDPPEPDKKAQLQSIQDKLRKKPTSESRVSEKTN 165 T + P EPD+K+QLQSIQ+KL+KK T+E RVSEKTN Sbjct: 67 TTTVPSEPDRKSQLQSIQNKLKKKSTTEFRVSEKTN 102 >XP_019463495.1 PREDICTED: probable ATP-dependent RNA helicase DDX46 [Lupinus angustifolius] Length = 340 Score = 52.0 bits (123), Expect = 5e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 64 SDPPEPDKKAQLQSIQDKLRKKPTSESRVSEKT 162 S+P E DK+AQ+QSIQ KL+KKP+SESRVSE+T Sbjct: 63 SNPSESDKQAQIQSIQSKLKKKPSSESRVSERT 95 >OIW00349.1 hypothetical protein TanjilG_27600 [Lupinus angustifolius] Length = 603 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 64 SDPPEPDKKAQLQSIQDKLRKKPTSESRVSEKT 162 S+P E DK+AQ+QSIQ KL+KKP+SESRVSE+T Sbjct: 63 SNPSESDKQAQIQSIQSKLKKKPSSESRVSERT 95