BLASTX nr result
ID: Glycyrrhiza30_contig00016703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016703 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004513357.1 PREDICTED: translation initiation factor eIF-2B s... 82 5e-16 XP_015946444.1 PREDICTED: translation initiation factor eIF-2B s... 80 3e-15 XP_016180994.1 PREDICTED: translation initiation factor eIF-2B s... 80 3e-15 XP_013451268.1 translation initiation factor eIF-2B delta subuni... 75 1e-13 XP_003554977.1 PREDICTED: probable translation initiation factor... 72 2e-12 XP_019452993.1 PREDICTED: translation initiation factor eIF-2B s... 71 4e-12 KYP39498.1 Translation initiation factor eIF-2B subunit delta [C... 70 6e-12 XP_014514302.1 PREDICTED: translation initiation factor eIF-2B s... 66 3e-10 XP_007151757.1 hypothetical protein PHAVU_004G072200g [Phaseolus... 66 3e-10 XP_003543906.1 PREDICTED: translation initiation factor eIF-2B s... 66 3e-10 XP_014620750.1 PREDICTED: translation initiation factor eIF-2B s... 66 3e-10 GAU46744.1 hypothetical protein TSUD_286040 [Trifolium subterran... 64 3e-10 KOM56070.1 hypothetical protein LR48_Vigan10g196200 [Vigna angul... 65 3e-10 XP_017440147.1 PREDICTED: probable translation initiation factor... 65 3e-10 XP_018812112.1 PREDICTED: translation initiation factor eIF-2B s... 64 1e-09 XP_018812111.1 PREDICTED: translation initiation factor eIF-2B s... 64 1e-09 XP_018812110.1 PREDICTED: translation initiation factor eIF-2B s... 64 1e-09 XP_012852525.1 PREDICTED: translation initiation factor eIF-2B s... 62 6e-09 KZV45594.1 translation initiation factor eIF-2B subunit delta [D... 62 8e-09 XP_019195088.1 PREDICTED: translation initiation factor eIF-2B s... 60 3e-08 >XP_004513357.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like [Cicer arietinum] Length = 654 Score = 82.0 bits (201), Expect = 5e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDP RRAPRT+IDPVPK RQVGFFAPGAPPERS SGPPDP Sbjct: 1 MDPPRRAPRTIIDPVPKFRQVGFFAPGAPPERSQSGPPDP 40 >XP_015946444.1 PREDICTED: translation initiation factor eIF-2B subunit delta [Arachis duranensis] Length = 675 Score = 79.7 bits (195), Expect = 3e-15 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDPSRRAPR+ IDPVPK RQVGFF PGAPPERS SGPPDP Sbjct: 1 MDPSRRAPRSAIDPVPKFRQVGFFTPGAPPERSQSGPPDP 40 >XP_016180994.1 PREDICTED: translation initiation factor eIF-2B subunit delta [Arachis ipaensis] Length = 677 Score = 79.7 bits (195), Expect = 3e-15 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDPSRRAPR+ IDPVPK RQVGFF PGAPPERS SGPPDP Sbjct: 1 MDPSRRAPRSAIDPVPKFRQVGFFTPGAPPERSQSGPPDP 40 >XP_013451268.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] KEH25307.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] Length = 651 Score = 75.1 bits (183), Expect = 1e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDP RR PRT+IDPVPK RQVGFF P APP+RS SGPPDP Sbjct: 1 MDPPRRPPRTIIDPVPKFRQVGFFTPSAPPDRSQSGPPDP 40 >XP_003554977.1 PREDICTED: probable translation initiation factor eIF-2B subunit delta [Glycine max] KRG93828.1 hypothetical protein GLYMA_19G044300 [Glycine max] Length = 660 Score = 71.6 bits (174), Expect = 2e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDPSRRAPR VIDP+PK+RQVGFF APPERS SGPPDP Sbjct: 1 MDPSRRAPRAVIDPIPKIRQVGFF---APPERSQSGPPDP 37 >XP_019452993.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like [Lupinus angustifolius] OIW06510.1 hypothetical protein TanjilG_26699 [Lupinus angustifolius] Length = 618 Score = 70.9 bits (172), Expect = 4e-12 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 115 PSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 P RRAPR VIDP+P++RQVGF PGAPP+RS SGPPDP Sbjct: 4 PPRRAPRPVIDPIPRIRQVGFITPGAPPDRSQSGPPDP 41 >KYP39498.1 Translation initiation factor eIF-2B subunit delta [Cajanus cajan] Length = 645 Score = 70.5 bits (171), Expect = 6e-12 Identities = 34/40 (85%), Positives = 34/40 (85%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDPSRRAPR VIDPVPK RQVGFF APPERS SGPPDP Sbjct: 1 MDPSRRAPRAVIDPVPKFRQVGFF---APPERSQSGPPDP 37 >XP_014514302.1 PREDICTED: translation initiation factor eIF-2B subunit delta [Vigna radiata var. radiata] Length = 647 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPD 5 MDPSRRAPR VIDPVPK RQVGFF APPERS SGPP+ Sbjct: 1 MDPSRRAPRAVIDPVPKFRQVGFF---APPERSQSGPPN 36 >XP_007151757.1 hypothetical protein PHAVU_004G072200g [Phaseolus vulgaris] ESW23751.1 hypothetical protein PHAVU_004G072200g [Phaseolus vulgaris] Length = 647 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPD 5 MDPSRRAPR VIDPVPK RQVGFF APPERS SGPP+ Sbjct: 1 MDPSRRAPRAVIDPVPKFRQVGFF---APPERSQSGPPN 36 >XP_003543906.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X2 [Glycine max] KRH18264.1 hypothetical protein GLYMA_13G047500 [Glycine max] Length = 659 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDPSRRAPR VIDPVPK+RQVGFF APPE S SGP DP Sbjct: 1 MDPSRRAPRAVIDPVPKIRQVGFF---APPESSQSGPLDP 37 >XP_014620750.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X1 [Glycine max] Length = 685 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDPSRRAPR VIDPVPK+RQVGFF APPE S SGP DP Sbjct: 1 MDPSRRAPRAVIDPVPKIRQVGFF---APPESSQSGPLDP 37 >GAU46744.1 hypothetical protein TSUD_286040 [Trifolium subterraneum] Length = 168 Score = 63.5 bits (153), Expect = 3e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGP 11 MDPSRRAPRTVIDPVPK RQVGFF APP+RS SGP Sbjct: 1 MDPSRRAPRTVIDPVPKFRQVGFF---APPDRSQSGP 34 >KOM56070.1 hypothetical protein LR48_Vigan10g196200 [Vigna angularis] Length = 644 Score = 65.5 bits (158), Expect = 3e-10 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPP 8 MDPSRRAPR VIDPVPK RQVGFF APPERS SGPP Sbjct: 1 MDPSRRAPRAVIDPVPKFRQVGFF---APPERSQSGPP 35 >XP_017440147.1 PREDICTED: probable translation initiation factor eIF-2B subunit delta [Vigna angularis] BAU01690.1 hypothetical protein VIGAN_11097300 [Vigna angularis var. angularis] Length = 647 Score = 65.5 bits (158), Expect = 3e-10 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPP 8 MDPSRRAPR VIDPVPK RQVGFF APPERS SGPP Sbjct: 1 MDPSRRAPRAVIDPVPKFRQVGFF---APPERSQSGPP 35 >XP_018812112.1 PREDICTED: translation initiation factor eIF-2B subunit delta isoform X3 [Juglans regia] Length = 668 Score = 63.9 bits (154), Expect = 1e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 M+P RRAPRTVIDP KVRQVGFFAPGAPPER+ SGPP P Sbjct: 1 MEP-RRAPRTVIDP--KVRQVGFFAPGAPPERAVSGPPAP 37 >XP_018812111.1 PREDICTED: translation initiation factor eIF-2B subunit delta isoform X2 [Juglans regia] Length = 669 Score = 63.9 bits (154), Expect = 1e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 M+P RRAPRTVIDP KVRQVGFFAPGAPPER+ SGPP P Sbjct: 1 MEP-RRAPRTVIDP--KVRQVGFFAPGAPPERAVSGPPAP 37 >XP_018812110.1 PREDICTED: translation initiation factor eIF-2B subunit delta isoform X1 [Juglans regia] Length = 672 Score = 63.9 bits (154), Expect = 1e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 M+P RRAPRTVIDP KVRQVGFFAPGAPPER+ SGPP P Sbjct: 1 MEP-RRAPRTVIDP--KVRQVGFFAPGAPPERAVSGPPAP 37 >XP_012852525.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like [Erythranthe guttata] EYU44301.1 hypothetical protein MIMGU_mgv1a002802mg [Erythranthe guttata] Length = 636 Score = 62.0 bits (149), Expect = 6e-09 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDP RRAPRTV DP KVR VGFFAPGAPP+RSHS P DP Sbjct: 1 MDP-RRAPRTVSDP--KVRHVGFFAPGAPPDRSHSVPTDP 37 >KZV45594.1 translation initiation factor eIF-2B subunit delta [Dorcoceras hygrometricum] Length = 639 Score = 61.6 bits (148), Expect = 8e-09 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDP RR PRTV DP K RQVGFFAPGAPP+RS S PPDP Sbjct: 1 MDP-RRVPRTVSDP--KFRQVGFFAPGAPPDRSQSAPPDP 37 >XP_019195088.1 PREDICTED: translation initiation factor eIF-2B subunit delta isoform X2 [Ipomoea nil] Length = 591 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -1 Query: 112 SRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 SRR R V DP KVRQVGFFAPGAPP+RS SGPPDP Sbjct: 3 SRRVSRAVSDP--KVRQVGFFAPGAPPDRSQSGPPDP 37