BLASTX nr result
ID: Glycyrrhiza30_contig00016689
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016689 (227 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007155611.1 hypothetical protein PHAVU_003G216400g [Phaseolus... 73 9e-15 XP_002304446.1 zinc finger family protein [Populus trichocarpa] ... 73 2e-14 XP_011016349.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 73 2e-14 XP_011033864.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 73 2e-14 XP_008437167.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 8e-14 XP_004147562.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 8e-14 KHG20851.1 Zinc finger A20 and AN1 domain-containing stress-asso... 72 1e-13 XP_017638680.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 1e-13 XP_016755559.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 1e-13 XP_012471948.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 1e-13 XP_017634178.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 1e-13 XP_012439574.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 1e-13 XP_016736975.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 1e-13 XP_015865800.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 1e-13 XP_007040022.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 71 1e-13 XP_012486718.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 70 2e-13 XP_017608229.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 70 2e-13 XP_016670680.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 70 2e-13 XP_012486717.1 PREDICTED: zinc finger A20 and AN1 domain-contain... 70 2e-13 AKS36842.1 zinc finger A20 and AN1 domain-containing stress-asso... 70 4e-13 >XP_007155611.1 hypothetical protein PHAVU_003G216400g [Phaseolus vulgaris] ESW27605.1 hypothetical protein PHAVU_003G216400g [Phaseolus vulgaris] Length = 147 Score = 73.2 bits (178), Expect = 9e-15 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGSQQN+G S+PPSE KPC NNCGFFG N NLCSKCY Sbjct: 1 MGSQQNNGTSYPPSEPKPCANNCGFFGNPDNENLCSKCY 39 >XP_002304446.1 zinc finger family protein [Populus trichocarpa] EEE79425.1 zinc finger family protein [Populus trichocarpa] Length = 174 Score = 72.8 bits (177), Expect = 2e-14 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QNDG SFPP+E K CVN CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNDGTSFPPAEPKLCVNGCGFFGTAANMNLCSKCY 39 >XP_011016349.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Populus euphratica] Length = 175 Score = 72.8 bits (177), Expect = 2e-14 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QNDG SFPP+E K CVN CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNDGTSFPPAEPKLCVNGCGFFGTAANMNLCSKCY 39 >XP_011033864.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Populus euphratica] Length = 175 Score = 72.8 bits (177), Expect = 2e-14 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QNDG SFPP+E K CVN CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNDGTSFPPAEPKLCVNGCGFFGTAANMNLCSKCY 39 >XP_008437167.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Cucumis melo] Length = 168 Score = 71.2 bits (173), Expect = 8e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QNDG S+ PSE K CVNNCGFFG+AG NLCSKCY Sbjct: 1 MGSEQNDGTSYQPSEPKLCVNNCGFFGSAGTENLCSKCY 39 >XP_004147562.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Cucumis sativus] KGN50181.1 hypothetical protein Csa_5G157400 [Cucumis sativus] Length = 168 Score = 71.2 bits (173), Expect = 8e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QNDG S+ PSE K CVNNCGFFG+AG NLCSKCY Sbjct: 1 MGSEQNDGTSYQPSEPKLCVNNCGFFGSAGTENLCSKCY 39 >KHG20851.1 Zinc finger A20 and AN1 domain-containing stress-associated 7 -like protein [Gossypium arboreum] Length = 218 Score = 72.0 bits (175), Expect = 1e-13 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +1 Query: 97 RHQNMGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 R + MGS+QN+G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 44 RKEIMGSEQNEGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 86 >XP_017638680.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Gossypium arboreum] Length = 166 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN+G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNEGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_016755559.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Gossypium hirsutum] Length = 166 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN+G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNEGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_012471948.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Gossypium raimondii] XP_016705645.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Gossypium hirsutum] KJB20838.1 hypothetical protein B456_003G167800 [Gossypium raimondii] KJB20839.1 hypothetical protein B456_003G167800 [Gossypium raimondii] KJB20840.1 hypothetical protein B456_003G167800 [Gossypium raimondii] Length = 166 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN+G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNEGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_017634178.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Gossypium arboreum] Length = 171 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN+G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNEGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_012439574.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Gossypium raimondii] KJB51967.1 hypothetical protein B456_008G240900 [Gossypium raimondii] Length = 171 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN+G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNEGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_016736975.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Gossypium hirsutum] ABD65463.1 DNA binding/zinc ion binding protein [Gossypium hirsutum] Length = 171 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN+G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNEGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_015865800.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Ziziphus jujuba] Length = 172 Score = 70.9 bits (172), Expect = 1e-13 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+Q++G S+ PSE KPC NNCGFFGTAG NLCSKCY Sbjct: 1 MGSEQSEGTSYQPSEPKPCANNCGFFGTAGTMNLCSKCY 39 >XP_007040022.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Theobroma cacao] EOY24523.1 A20/AN1-like zinc finger family protein, putative [Theobroma cacao] Length = 173 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN+G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNEGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_012486718.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1 isoform X2 [Gossypium raimondii] XP_012486719.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1 isoform X3 [Gossypium raimondii] Length = 155 Score = 70.1 bits (170), Expect = 2e-13 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNQGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_017608229.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Gossypium arboreum] Length = 169 Score = 70.1 bits (170), Expect = 2e-13 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNQGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_016670680.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Gossypium hirsutum] XP_016677169.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Gossypium hirsutum] Length = 169 Score = 70.1 bits (170), Expect = 2e-13 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNQGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >XP_012486717.1 PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1 isoform X1 [Gossypium raimondii] KJB37574.1 hypothetical protein B456_006G211300 [Gossypium raimondii] Length = 169 Score = 70.1 bits (170), Expect = 2e-13 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QN G SFPPSE K C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNQGTSFPPSEPKLCANGCGFFGTAANMNLCSKCY 39 >AKS36842.1 zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Hevea brasiliensis] Length = 178 Score = 69.7 bits (169), Expect = 4e-13 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 109 MGSQQNDGMSFPPSELKPCVNNCGFFGTAGNNNLCSKCY 225 MGS+QNDG SFPPSE C N CGFFGTA N NLCSKCY Sbjct: 1 MGSEQNDGTSFPPSEPLLCANGCGFFGTAANMNLCSKCY 39