BLASTX nr result
ID: Glycyrrhiza30_contig00016578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016578 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48499.1 hypothetical protein TSUD_291850 [Trifolium subterran... 76 3e-19 >GAU48499.1 hypothetical protein TSUD_291850 [Trifolium subterraneum] Length = 195 Score = 75.9 bits (185), Expect(2) = 3e-19 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 209 GVGTLYWVAAFRYTALRCRQPYAVEQQSLEACHL 108 GVGTLYWVAAFRYTALRCRQPYAVEQQSLEACHL Sbjct: 162 GVGTLYWVAAFRYTALRCRQPYAVEQQSLEACHL 195 Score = 46.6 bits (109), Expect(2) = 3e-19 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 271 DWEGHRLGTFRSYHRRVRQIQALVHYTGW 185 D EGHRLGTFRSYHRRVRQI+A V W Sbjct: 140 DGEGHRLGTFRSYHRRVRQIKAGVGTLYW 168