BLASTX nr result
ID: Glycyrrhiza30_contig00016547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016547 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019428029.1 PREDICTED: germin-like protein subfamily 3 member... 96 3e-23 ACU24445.1 unknown [Glycine max] 95 4e-23 XP_004497160.1 PREDICTED: germin-like protein subfamily 3 member... 96 7e-23 KHN11468.1 Germin-like protein subfamily 3 member 2 [Glycine soj... 95 9e-23 XP_016176394.1 PREDICTED: germin-like protein subfamily 3 member... 95 1e-22 XP_015942121.1 PREDICTED: germin-like protein subfamily 3 member... 95 1e-22 GAU18005.1 hypothetical protein TSUD_51150 [Trifolium subterraneum] 94 1e-22 NP_001239847.1 germin-like protein subfamily 3 member 2-like pre... 95 2e-22 KYP69159.1 Germin-like protein subfamily 3 member 2 [Cajanus cajan] 94 4e-22 XP_019441337.1 PREDICTED: germin-like protein subfamily 3 member... 93 5e-22 XP_018846047.1 PREDICTED: germin-like protein subfamily 3 member... 92 6e-22 XP_013470283.1 germin family 1 protein [Medicago truncatula] KEH... 92 1e-21 XP_018851800.1 PREDICTED: germin-like protein subfamily 3 member... 92 1e-21 XP_008375565.1 PREDICTED: germin-like protein subfamily 3 member... 92 2e-21 XP_004307060.1 PREDICTED: germin-like protein subfamily 3 member... 91 7e-21 XP_007142844.1 hypothetical protein PHAVU_007G021700g [Phaseolus... 90 2e-20 XP_010088793.1 Germin-like protein subfamily 3 member 2 [Morus n... 89 4e-20 XP_004135363.1 PREDICTED: germin-like protein subfamily 3 member... 88 4e-20 XP_016699370.1 PREDICTED: germin-like protein subfamily 3 member... 88 5e-20 XP_007213855.1 hypothetical protein PRUPE_ppa016341mg [Prunus pe... 88 5e-20 >XP_019428029.1 PREDICTED: germin-like protein subfamily 3 member 2 [Lupinus angustifolius] OIV90962.1 hypothetical protein TanjilG_16922 [Lupinus angustifolius] Length = 209 Score = 96.3 bits (238), Expect = 3e-23 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 +AVNSNVFP L+ LG FVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG Sbjct: 71 VAVNSNVFPGLNTLGVSFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 121 >ACU24445.1 unknown [Glycine max] Length = 174 Score = 95.1 bits (235), Expect = 4e-23 Identities = 45/51 (88%), Positives = 46/51 (90%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 MAVNSNVFP L+ LG FVRADF VGGVNVPHFHPRATEVAFVLEGKIYSG Sbjct: 71 MAVNSNVFPGLNTLGVSFVRADFGVGGVNVPHFHPRATEVAFVLEGKIYSG 121 >XP_004497160.1 PREDICTED: germin-like protein subfamily 3 member 2 [Cicer arietinum] Length = 209 Score = 95.5 bits (236), Expect = 7e-23 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 M VNSN+FP L+ LG FVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG Sbjct: 71 MGVNSNIFPGLNTLGMSFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 121 >KHN11468.1 Germin-like protein subfamily 3 member 2 [Glycine soja] KRG90715.1 hypothetical protein GLYMA_20G110100 [Glycine max] Length = 209 Score = 95.1 bits (235), Expect = 9e-23 Identities = 45/51 (88%), Positives = 46/51 (90%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 MAVNSNVFP L+ LG FVRADF VGGVNVPHFHPRATEVAFVLEGKIYSG Sbjct: 71 MAVNSNVFPGLNTLGVSFVRADFGVGGVNVPHFHPRATEVAFVLEGKIYSG 121 >XP_016176394.1 PREDICTED: germin-like protein subfamily 3 member 2 [Arachis ipaensis] Length = 208 Score = 94.7 bits (234), Expect = 1e-22 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 +AVNSNVFP L+ LG FVRADFDVGG+NVPH+HPRATEVAFVLEGKIYSG Sbjct: 71 VAVNSNVFPGLNTLGVSFVRADFDVGGINVPHYHPRATEVAFVLEGKIYSG 121 >XP_015942121.1 PREDICTED: germin-like protein subfamily 3 member 2 [Arachis duranensis] Length = 208 Score = 94.7 bits (234), Expect = 1e-22 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 +AVNSNVFP L+ LG FVRADFDVGG+NVPH+HPRATEVAFVLEGKIYSG Sbjct: 71 VAVNSNVFPGLNTLGVSFVRADFDVGGINVPHYHPRATEVAFVLEGKIYSG 121 >GAU18005.1 hypothetical protein TSUD_51150 [Trifolium subterraneum] Length = 183 Score = 94.0 bits (232), Expect = 1e-22 Identities = 44/51 (86%), Positives = 45/51 (88%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 M VNSNVFP L+ LG FVRADFDVGGVNVPHFHPRATEVA VLEGKIYSG Sbjct: 45 MGVNSNVFPGLNTLGVSFVRADFDVGGVNVPHFHPRATEVAIVLEGKIYSG 95 >NP_001239847.1 germin-like protein subfamily 3 member 2-like precursor [Glycine max] ACG69494.1 germin-like protein 18 [Glycine max] Length = 231 Score = 95.1 bits (235), Expect = 2e-22 Identities = 45/51 (88%), Positives = 46/51 (90%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 MAVNSNVFP L+ LG FVRADF VGGVNVPHFHPRATEVAFVLEGKIYSG Sbjct: 71 MAVNSNVFPGLNTLGVSFVRADFGVGGVNVPHFHPRATEVAFVLEGKIYSG 121 >KYP69159.1 Germin-like protein subfamily 3 member 2 [Cajanus cajan] Length = 209 Score = 93.6 bits (231), Expect = 4e-22 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 MAVNSNVFP L+ LG FVRADF VGGVNVPHFHPRATEVAFVLEG++YSG Sbjct: 71 MAVNSNVFPGLNTLGVSFVRADFGVGGVNVPHFHPRATEVAFVLEGRVYSG 121 >XP_019441337.1 PREDICTED: germin-like protein subfamily 3 member 2 [Lupinus angustifolius] OIW12968.1 hypothetical protein TanjilG_15417 [Lupinus angustifolius] Length = 209 Score = 93.2 bits (230), Expect = 5e-22 Identities = 44/51 (86%), Positives = 45/51 (88%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 M VNSNVF L+ LG FVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG Sbjct: 71 MGVNSNVFSGLNTLGVSFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 121 >XP_018846047.1 PREDICTED: germin-like protein subfamily 3 member 2 [Juglans regia] Length = 185 Score = 92.4 bits (228), Expect = 6e-22 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 M VNSNVFP L+ LG FVRADFDVGG+NVPHFHPRATE AFVLEG+IYSG Sbjct: 47 MPVNSNVFPGLNTLGMSFVRADFDVGGINVPHFHPRATETAFVLEGRIYSG 97 >XP_013470283.1 germin family 1 protein [Medicago truncatula] KEH44321.1 germin family 1 protein [Medicago truncatula] Length = 210 Score = 92.4 bits (228), Expect = 1e-21 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 M VNSNVFP L+ LG FVRADFD GGVNVPHFHPRATEVA VLEGKIYSG Sbjct: 72 MGVNSNVFPGLNTLGVSFVRADFDAGGVNVPHFHPRATEVAIVLEGKIYSG 122 >XP_018851800.1 PREDICTED: germin-like protein subfamily 3 member 2 [Juglans regia] Length = 213 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 M VNSNVFP L+ LG FVRADFDVGG+NVPHFHPRATE AFVLEG+IYSG Sbjct: 75 MPVNSNVFPGLNTLGMSFVRADFDVGGINVPHFHPRATETAFVLEGRIYSG 125 >XP_008375565.1 PREDICTED: germin-like protein subfamily 3 member 2 [Malus domestica] Length = 213 Score = 91.7 bits (226), Expect = 2e-21 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 ++VNSNVFP L+ LG FVRADF+VGGVNVPHFHPRATE AFVLEGKIYSG Sbjct: 75 VSVNSNVFPGLNTLGMSFVRADFEVGGVNVPHFHPRATETAFVLEGKIYSG 125 >XP_004307060.1 PREDICTED: germin-like protein subfamily 3 member 2 [Fragaria vesca subsp. vesca] Length = 214 Score = 90.5 bits (223), Expect = 7e-21 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 ++VNSNVFP L+ LG FVRADF+VGGVNVPH+HPRATE AFVLEGKIYSG Sbjct: 76 ISVNSNVFPGLNTLGMSFVRADFEVGGVNVPHYHPRATETAFVLEGKIYSG 126 >XP_007142844.1 hypothetical protein PHAVU_007G021700g [Phaseolus vulgaris] ESW14838.1 hypothetical protein PHAVU_007G021700g [Phaseolus vulgaris] Length = 223 Score = 89.7 bits (221), Expect = 2e-20 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = -3 Query: 212 VNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 VNSNVFP L+ LG FVRADF VGGVNVPHFHPRATEV FVLEGK+YSG Sbjct: 87 VNSNVFPGLNTLGVSFVRADFGVGGVNVPHFHPRATEVGFVLEGKVYSG 135 >XP_010088793.1 Germin-like protein subfamily 3 member 2 [Morus notabilis] EXB36976.1 Germin-like protein subfamily 3 member 2 [Morus notabilis] Length = 213 Score = 88.6 bits (218), Expect = 4e-20 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 215 AVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 +V SNVFP L+ LG FVRADF+VGGVNVPHFHPRATE AFVLEGK+YSG Sbjct: 76 SVTSNVFPGLNTLGMSFVRADFEVGGVNVPHFHPRATETAFVLEGKVYSG 125 >XP_004135363.1 PREDICTED: germin-like protein subfamily 3 member 2 [Cucumis sativus] Length = 209 Score = 88.2 bits (217), Expect(2) = 4e-20 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 +AVNS VFP L+ LG VRADFDVGGVNVPHFHPRATEVA VLEGK+YSG Sbjct: 71 IAVNSKVFPGLNTLGMSLVRADFDVGGVNVPHFHPRATEVAVVLEGKVYSG 121 Score = 37.0 bits (84), Expect(2) = 4e-20 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -1 Query: 67 EKRQVMVFPTGLLHLQINVGEV 2 EK +VMVFP GL+H Q+NVGE+ Sbjct: 135 EKGEVMVFPRGLVHFQMNVGEI 156 >XP_016699370.1 PREDICTED: germin-like protein subfamily 3 member 2 [Gossypium hirsutum] Length = 208 Score = 88.2 bits (217), Expect = 5e-20 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 215 AVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 +VN N+FP L+ LG FVRADF+VGG+N+PHFHPRATE+AFVLEGKIYSG Sbjct: 71 SVNVNIFPGLNTLGMSFVRADFEVGGINMPHFHPRATEIAFVLEGKIYSG 120 >XP_007213855.1 hypothetical protein PRUPE_ppa016341mg [Prunus persica] Length = 211 Score = 88.2 bits (217), Expect = 5e-20 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -3 Query: 218 MAVNSNVFPSLDALGAKFVRADFDVGGVNVPHFHPRATEVAFVLEGKIYSG 66 ++VNSNVFP L+ LG VRADF+VGGVNVPHFHPRATE+AFVLEG IYSG Sbjct: 73 VSVNSNVFPGLNTLGMSLVRADFEVGGVNVPHFHPRATEIAFVLEGTIYSG 123